KEGG   Lactococcus garvieae Lg2: LCGL_0491Help
Entry
LCGL_0491         CDS       T01963                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507457..508890
Genome map
AA seq 477 aa AA seqDB search
MPLSKDFLWGGATAANQYEGGWNQGGRGLANVDLAPHGSHREAIILGLEKHLQPEEVLFY
PGHEAIDFYNHWQEDIALFAEMGFKTFRMSIAWSRIFPKGDETQPNEEGIMFYEKVFKEL
RKYDIEPLVTITHFDIPMHLVTEYGGWRNRRLVDFYENLVIVLFTRYKGLVKYWLTFNEI
NMLLHAPFMGAGVYIEEGENRDQVLFTAAHHELVASALATKIGHQIDPENKIGCMVAAGD
YYPWDSKPENVREALDKNRENLFLIDVQARGKYPNYFLKQLEREGLALPLLESDEELLAQ
NTVDFVSFSYYSSRVAKVQEEGDEETSGNIFASVKNPYLKASEWGWQIDPVGLRTTMNTL
YDRYQKPLFIVENGLGAIDKPDETGYVADDYRIAYMAEHIAEMIKAVELDGVELLGYTSW
GCIDLVSAGTGEMSKRYGFIYVDRDDQGNGTLKRTPKKSFDWYKKVIASNGQDLSNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccattatctaaagattttctctggggcggcgcaacagctgctaaccaatatgaaggc
ggctggaatcaaggtggtcgaggacttgccaatgtagatttagccccacacggctcacat
cgggaagccattattttagggcttgaaaagcatttacaaccggaagaagtgcttttctat
cccgggcacgaggctattgatttttacaaccactggcaagaagatattgctttgtttgct
gaaatggggttcaaaactttccgcatgtctattgcttggtcacggatttttccaaaaggt
gacgaaactcaacctaacgaagaaggaataatgttttatgaaaaggtctttaaagagctg
cgtaagtatgatattgaacctttagtaaccatcacgcactttgacattccgatgcactta
gtaacagaatatgggggctggcgtaatcgtcgactggttgatttttacgaaaacttagtc
atagttctctttacacgttacaaaggcttggtcaaatattggcttacctttaacgaaatc
aatatgctcttgcatgctccgtttatgggcgcaggtgtttacattgaagaaggggaaaat
cgggatcaagtcctttttacagcggcacatcatgaacttgtcgcctccgccttagcgaca
aaaattggccaccaaatagacccagaaaataagattggctgtatggtagctgctggagat
tactatccttgggattctaaaccagaaaatgtccgtgaagcactcgataaaaaccgtgag
aaccttttcttgattgatgtacaagcacgtggcaaatatccaaattatttcttgaaacaa
cttgaacgtgagggacttgctttacctcttcttgaaagcgatgaagaactgcttgctcag
aatactgttgatttcgtatccttctcttactactcaagccgcgttgcaaaagttcaggaa
gaaggggacgaagaaacttcaggtaatatctttgcctcggttaaaaatccttacctcaaa
gcatctgaatggggctggcagattgatcctgtgggtctacgcacaacaatgaacacgctc
tatgatcgctatcaaaaaccactttttattgttgaaaatggcttaggggctatagataaa
ccagatgaaacaggttatgtagcagatgattatcgtatcgcttatatggctgaacatatc
gcagaaatgatcaaagcagtcgagttagacggtgtagaacttttgggctatacttcatgg
gggtgtattgacttagtatcggctggaaccggtgagatgtctaaacgttatggatttatc
tatgttgatcgtgatgaccaagggaatgggactctaaagcgtacgccgaaaaaatccttt
gactggtataaaaaagttattgcttcaaatgggcaagatttaagcaataactaa

DBGET integrated database retrieval system