KEGG   Lactococcus garvieae Lg2: LCGL_0593Help
Entry
LCGL_0593         CDS       T01963                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCGL_0593
Enzymes [BR:lgv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LCGL_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611489..613144
Genome map
AA seq 551 aa AA seqDB search
MNVKIKEKLILLYGERADEAEKELEKVLNKFAQRDFPQKEKINEKNAYLIAYGDSILREG
QTPLATLNEVLSETIAGAITDVHLLPMFPFTSDDGFSVTDYYKINPQYGTWEDIEHLSKN
YRLMFDFVANHMSKDSEWFQSFLQEEEDFKEAFVIFDEEFDASNTVRPRTSPLFHNYKGK
KVWTTFSEDQVDVNIKDPKMFARLTEVLLTYASKGAASIRLDAIGFLWKESGSRSIHLWQ
THEVIKIWRKLLEELSPNTQIITETNVPHEENISYFGKNDEANQVYQFPLPPLVLHSFTV
GDAQKLSAWAKGIEGRGDTETFFNFLASHDGIGMRPTEGILSDVERNNLVEKVIENGGEI
SYKENTDGSRSVYELNINYSEALRNKGETDEIAVEKMKAAHSILFSVIGVPAIYYHSLFG
SRNDYKGVLDSGINRRINREKLSAERLLDELKSDPYRNGIYTGLKKMLEKRAQYKAFSPY
GKQEILDIDKRVFAVKRTHLNQEIISITNVSNQKVTLYGLEGMDIIKEKTIPKQMELEPY
AYIWCYNNTNK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaaataaaagaaaaactgattcttctttatggagaaagagcagacgaagca
gagaaagagttggaaaaagttcttaataagtttgctcaacgagattttcctcaaaaagaa
aaaattaatgaaaaaaatgcctatcttatagcctatggagatagtattttgagagaaggg
caaactcctttagcaacattgaatgaagttttaagtgagacaattgcgggagcgataaca
gatgtccacttactccccatgtttccttttacttctgatgacggtttttcagtaacagat
tattataagattaatccgcagtatggaacttgggaagacattgaacatctttcaaaaaat
tatcggttaatgtttgattttgtcgctaatcacatgtcaaaagacagtgagtggtttcaa
agttttttacaagaagaagaagattttaaagaggctttcgtaatattcgatgaagaattt
gatgccagtaatacggtgagaccaagaacgagtcctctctttcataactataaagggaag
aaggtatggacaactttttctgaagatcaagtagacgttaatatcaaggatcccaagatg
tttgcccgcttaacagaagttttattaacatatgcttcaaaaggagccgcctcaatccgt
ttggatgcaattggctttttatggaaggaatctggcagtcgttcgatacatctttggcaa
acacatgaagttattaaaatatggcgaaaactgctagaagaactgtctcccaacacacaa
attattactgaaacgaatgttcctcatgaagaaaatatatcttatttcggtaagaatgat
gaggcaaaccaagtctaccaattcccgcttcctcccttagtattacattcttttactgtt
ggggatgctcaaaaattaagtgcatgggcaaaaggaattgaaggacgaggcgacacggaa
actttctttaactttttagcgagccatgatggtattggtatgcgaccaacagaaggtatt
ttaagtgatgttgaaagaaacaacctggtcgagaaggttattgaaaatggtggggaaatt
tcttataaagaaaatactgatggaagccgttctgtctatgaattgaatataaattattct
gaagctttaagaaataagggggagacggatgagatagcagtagaaaaaatgaaagctgct
cattccatcttattttctgttattggtgtaccagctatttattaccactctttatttggg
tcaagaaatgactataaaggcgttttagattcggggattaatcgaagaattaatcgcgaa
aaactttcagcagaacgattgttagatgagcttaaatctgatccttatcgtaatggaata
tacacgggcctgaaaaaaatgctggaaaaaagagcccaatacaaagctttttctccctac
ggaaagcaagaaatattggatattgataaaagagtgtttgcagtgaaaagaactcacctt
aatcaagaaattatttcaattaccaatgtgtccaatcagaaagtcacactttatggttta
gaaggaatggacattataaaagaaaaaacaatccctaaacaaatggagttagaaccttac
gcctacatttggtgctataataacactaacaagtaa

DBGET integrated database retrieval system