KEGG   Lactococcus garvieae Lg2: LCGL_0809Help
Entry
LCGL_0809         CDS       T01963                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LCGL_0809
Enzymes [BR:lgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LCGL_0809
Exosome [BR:lgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCGL_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826937..828433
Genome map
AA seq 498 aa AA seqDB search
MTETSYIMAIDQGTTSSRAIIFDKQGKHIGSSQKEFTQYFPKEGWVEHDANEIWNSVQSV
IAGAFIESGIKPVQVAGIGITNQRETTIIWDKKTGKPIYHAIVWQSRQSADIANGLKEAG
HEELFHKKTGLIVDSYFSATKIRWILDHVEGAQERAERGELLFGTIDTWLLWKLTDGDAH
YTDYSNASRTMLYNIHELKWDEEILKILNIPVSMLPEVKSNSEVYGVTKGFHFFGSEVPI
SGMAGDQQAALFGQMAFEPGMIKNTYGTGSFIVMNTGEKPHISKNNMLTTIGYGINGKVY
YALEGSIFVAGSSIQWLRDGLKMLERASDSEEVALQSRSQDEVYVVPAFVGLGAPYWDQE
ARGAMFGLTRGTTKEDIVKATLQGIAYQVRDVVSTMKEDTGIDMSVLKVDGGAANNEYLM
QFQADILNIPIQRAGDLETTALGAAFLAGLAVGFWKDLEELKESYEPGKIFQTQMQEERR
EELYAGWKKAVNATRAFK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacttcttacattatggcaattgaccaaggtacgacaagctcaagagctatt
atatttgataaacagggcaaacacattggcagttcccaaaaagaatttacacaatacttc
cctaaagaaggttgggttgaacatgatgccaacgagatttggaactctgttcagtctgtt
atcgcaggggcttttatcgagtcgggaattaagcctgtacaggttgcgggtatcggtatc
actaaccaacgtgaaactaccattatatgggacaagaaaacaggaaaaccaatctatcat
gctattgtttggcaatctcgtcaatcagccgatattgctaatggtcttaaagaagcagga
catgaggaactcttccataaaaagacaggacttattgtagattcatatttttcagccaca
aaaattcgttggatccttgaccatgtcgaaggagcacaagagcgtgcagaacgcggagag
ctcctctttggaaccatcgatacatggctcttgtggaagttgacagatggtgatgcacac
tatactgactattctaatgccagccgtaccatgctctacaacattcatgagttgaaatgg
gacgaagaaatcctgaaaattcttaatatcccagtttcaatgcttccagaagtcaagtcc
aactcagaagtttacggcgtgactaaaggtttccatttctttggctctgaagtgccaatc
tcaggtatggcaggggaccagcaagctgcattatttggtcaaatggcttttgaacctgga
atgattaaaaatacctatggtacaggttcgtttatcgtcatgaacacaggtgagaaacca
catatttcgaaaaataatatgcttacaacgattggttatggcattaatgggaaagtttat
tacgccttagaaggaagcatctttgttgcagggtcctctatccaatggttacgtgatggt
ttgaaaatgttggaacgtgccagtgattccgaagaagtagcactccagtctaggagtcaa
gatgaagtttatgtggtgccagcttttgtcggccttggagctccgtattgggaccaagag
gcgcgtggtgcgatgtttggcttgacacgtggaacaacaaaagaagatattgtgaaagca
accttacaagggatagcttatcaagttcgtgatgtagtcagcaccatgaaagaagataca
ggaattgatatgtctgtgctcaaggtagacggtggcgctgcaaacaatgaatatttgatg
cagttccaagctgatatcttgaatatcccaatccaacgtgcgggagatttggaaacgaca
gcacttggtgcagccttccttgcaggacttgccgttggtttctggaaagacttagaagag
cttaaagaatcctatgaaccgggcaaaattttccaaactcagatgcaagaagagcgtaga
gaagaactctatgccggttggaaaaaagccgtgaatgcgacacgcgctttcaaataa

DBGET integrated database retrieval system