KEGG   Lactococcus garvieae Lg2: LCGL_0887Help
Entry
LCGL_0887         CDS       T01963                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LCGL_0887
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LCGL_0887
Enzymes [BR:lgv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LCGL_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917703..918191
Genome map
AA seq 162 aa AA seqDB search
MSIYDFTVKGKQGDDISLSDYKGKVLLVVNTATKCGFTPQYDGLQKLYDTYKEEGFEILD
FPCNQFKEQAPGTADEIDQFCTLNYGTTFPRFQKIDVNGADESPLYTWLKEEKGSPLGKK
IKWNFTKFLINAQGEVVARYAPATEPEKIAKDIKKELEKVEK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgattttacagtgaagggaaaacaaggagatgatatctctttatccgac
tataaaggaaaagttctacttgtggtgaatactgcgacaaaatgtggtttcacaccacag
tatgatgggctacaaaaactttatgacacatacaaagaagaaggatttgaaattctcgat
tttccttgtaatcaatttaaagaacaagcgccaggcacagctgatgaaatcgatcagttt
tgtacattgaactatggtacaacttttccacgctttcaaaaaattgatgtcaatggtgcg
gatgagagtccactctacacttggttaaaagaagaaaaaggaagcccgctggggaaaaaa
atcaagtggaatttcacgaagttcttgatcaatgctcaaggagaagttgtcgcacgttat
gcaccggcaacagagcctgaaaaaattgcgaaagatattaaaaaagagcttgaaaaagta
gaaaaatag

DBGET integrated database retrieval system