KEGG   Lactococcus garvieae Lg2: LCGL_0887Help
Entry
LCGL_0887         CDS       T01963                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lgv00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lgv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917703..918191
Genome map
AA seq 162 aa AA seqDB search
MSIYDFTVKGKQGDDISLSDYKGKVLLVVNTATKCGFTPQYDGLQKLYDTYKEEGFEILD
FPCNQFKEQAPGTADEIDQFCTLNYGTTFPRFQKIDVNGADESPLYTWLKEEKGSPLGKK
IKWNFTKFLINAQGEVVARYAPATEPEKIAKDIKKELEKVEK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgattttacagtgaagggaaaacaaggagatgatatctctttatccgac
tataaaggaaaagttctacttgtggtgaatactgcgacaaaatgtggtttcacaccacag
tatgatgggctacaaaaactttatgacacatacaaagaagaaggatttgaaattctcgat
tttccttgtaatcaatttaaagaacaagcgccaggcacagctgatgaaatcgatcagttt
tgtacattgaactatggtacaacttttccacgctttcaaaaaattgatgtcaatggtgcg
gatgagagtccactctacacttggttaaaagaagaaaaaggaagcccgctggggaaaaaa
atcaagtggaatttcacgaagttcttgatcaatgctcaaggagaagttgtcgcacgttat
gcaccggcaacagagcctgaaaaaattgcgaaagatattaaaaaagagcttgaaaaagta
gaaaaatag

DBGET integrated database retrieval system