KEGG   Lactococcus garvieae Lg2: LCGL_0967Help
Entry
LCGL_0967         CDS       T01963                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCGL_0967
Enzymes [BR:lgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LCGL_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992723..993631
Genome map
AA seq 302 aa AA seqDB search
MNKITIIGSINLDTTLRVSNMPKPGETLHAKEHFTAGGGKGANQAVAAKRSGADTFFIGA
IGKDGAGQMMRELLEYEDIDTSAVQLLESQSTGQAFITVDDSGENSIMIFSGANNAFTPE
HVENSKHIIENSDFLIAQFESALDSTVAAFKCAKENKVRTILNPAPARTDIPQELLATTD
IIVPNETEAELITGIKVEDEHSLKAAADYFHNLGIEAVIITLGSKGAYYDIKDGKSGIIP
AFKVAAVDTTAAGDTFIGALSTVLKADFSNIEDAILYGSKASSLTVQRYGAQPSIPYKNE
LD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatcacaattattggcagtatcaatctagatacaactttgagagtaagcaat
atgccgaaaccaggtgagactttacatgcaaaagaacattttactgccggtggcggtaaa
ggtgccaaccaagcggtagcagcaaagcgttctggtgctgatactttctttattggcgct
attggtaaagacggtgctgggcaaatgatgcgtgagcttttagagtatgaagatattgac
acatcagctgtccaactcttagaaagccaatcgacaggtcaagcctttattaccgtggat
gattctggtgaaaacagcattatgattttctcaggggcaaataatgcatttacccccgaa
cacgttgaaaactccaaacatattattgaaaatagtgattttttgattgcacaatttgaa
agcgcgcttgacagtacagtcgcagcctttaagtgtgcgaaagaaaataaggtgcggact
attctcaatcccgcacctgcgagaacggatattcctcaagaacttttggctacaacggat
atcattgtgcctaatgaaacagaagctgaactcataactggaataaaagtggaagatgag
cacagtctaaaagctgcggcagattatttccacaatcttggtattgaagcagtgattatt
accttaggaagcaagggggcttattatgacatcaaagatggcaagtctggtatcatcccc
gctttcaaggtagcggctgtcgatacaacagctgcaggtgatactttcattggcgcttta
agcactgttttgaaggcagacttcagtaatattgaggatgctattctttatggcagtaaa
gcctcatcactgactgtacaaagatacggcgcacaaccctctattccctacaaaaatgaa
ctggattag

DBGET integrated database retrieval system