KEGG   Lactococcus garvieae Lg2: LCGL_1008Help
Entry
LCGL_1008         CDS       T01963                                 

Definition
dihydropholate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LCGL_1008
   00670 One carbon pool by folate
    LCGL_1008
Enzymes [BR:lgv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LCGL_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1026844..1027359
Genome map
AA seq 171 aa AA seqDB search
MIYAIWAEDEKKVIGIDGHLPWRLPAELEHFKKTTYHQAILMGRKTFEGMNKRVLPGRIT
IVLTRDETYPKEDNDRVLIMHSVSEVVEWYNNQERDLYIIGGSEMFLLFENELSALYKTV
VHGEFAGDTYFPDTFDFSKYVKVSADYHKKDAQNPYDFTVEKYERKEKQKP
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgcaatctgggcagaggacgagaaaaaagtaattggcatcgatggtcattta
ccttggcgcttacctgctgaactcgaacattttaaaaagacaacgtatcatcaagcaatt
ttgatgggccgcaaaacctttgaaggcatgaataagcgtgtgcttcctggacgtatcact
atcgttcttacaagagatgaaacttatcccaaagaagataacgaccgtgtcctaatcatg
catagtgtatccgaagttgtagaatggtataataatcaagagcgtgatttatatatcatt
ggcggatcagagatgttccttcttttcgaaaatgagctatcagcgctctataaaacggtt
gttcatggagaatttgcaggggatacttatttccctgatacgtttgatttttcgaagtat
gtgaaagtgtcagcagattatcacaaaaaagacgcgcaaaatccttatgactttaccgtt
gaaaaatatgagcggaaggagaaacaaaagccgtga

DBGET integrated database retrieval system