KEGG   Lactococcus garvieae Lg2: LCGL_1242Help
Entry
LCGL_1242         CDS       T01963                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00071  Fatty acid degradation
lgv00072  Synthesis and degradation of ketone bodies
lgv00280  Valine, leucine and isoleucine degradation
lgv00362  Benzoate degradation
lgv00380  Tryptophan metabolism
lgv00620  Pyruvate metabolism
lgv00630  Glyoxylate and dicarboxylate metabolism
lgv00640  Propanoate metabolism
lgv00650  Butanoate metabolism
lgv00900  Terpenoid backbone biosynthesis
lgv01100  Metabolic pathways
lgv01110  Biosynthesis of secondary metabolites
lgv01120  Microbial metabolism in diverse environments
lgv01130  Biosynthesis of antibiotics
lgv01200  Carbon metabolism
lgv01212  Fatty acid metabolism
lgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCGL_1242
   00630 Glyoxylate and dicarboxylate metabolism
    LCGL_1242
   00640 Propanoate metabolism
    LCGL_1242
   00650 Butanoate metabolism
    LCGL_1242
  Lipid metabolism
   00071 Fatty acid degradation
    LCGL_1242
   00072 Synthesis and degradation of ketone bodies
    LCGL_1242
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCGL_1242
   00310 Lysine degradation
    LCGL_1242
   00380 Tryptophan metabolism
    LCGL_1242
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCGL_1242
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCGL_1242
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCGL_1242
Enzymes [BR:lgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCGL_1242
Exosome [BR:lgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCGL_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAK60702
UniProt: F9VEF1
Position
complement(1228127..1229269)
Genome map
AA seq 380 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALSDKTAAELGVHVVKNLLDRHEDIKDDVKQVIFGNVLQAG
TGQNIARQISINSGLSHHVPASTVNEVCGSGMKAVILAKQLLQLEEADVVIAGGTESMSQ
SPIIRHRKSGEEVLSMMSEGLIDAFNGESMGLIGETIAEQFEISREEQDRFAQRSQEKAL
AARTTGAFEKEIVPFSDLAEDETIRANSSLEKLSSLRTAFSENGSVTAGNSSPVNDGASA
LLLASNDYAEAKDLPVLAKLLASEEVGIDPEIMGVSPIRAIRQLLERTDLDIEDIDIFEI
NEAFAASSVAVNQELNIPEEKVNIYGGAIALGHAIGSSGARVLTTLAYALQRENKRYGIA
SVCIGGGLGLAVLLENPNLV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatagtaattatcgatgcgcttcgtacgcctgtcggaaaatatgatggtgct
ctgtcagataagacagctgcagaactgggtgttcatgtagttaaaaatctacttgatcgc
catgaagatattaaagatgacgtcaaacaagtgatttttggcaatgtactacaggctggt
acagggcaaaatattgcacgtcagatctcaatcaatagtggtctatctcaccatgttcca
gcttcaacggttaatgaagtctgtggttcaggtatgaaggcagtgattctcgctaaacaa
cttttacaacttgaggaagcggatgttgtgattgctgggggaacagagtccatgtctcaa
tctccaatcatccgtcaccgtaaatctggtgaagaagtgctttcaatgatgtctgagggc
ttaatagatgcgtttaatggtgaatcaatggggttgattggtgaaacaatcgccgagcaa
tttgaaattagccgtgaagaacaagatcgctttgctcaacgttcgcaagaaaaagcccta
gctgcacgtacaacgggtgcatttgaaaaagaaattgtgccattttcagatttagcagaa
gatgaaacaattcgtgcaaactcttcattagaaaaactttcttcactgcgtactgctttc
agtgagaacggcagtgtaactgcaggtaactcatcacccgtaaatgacggtgcgtccgct
ttgcttttagcaagcaatgactatgccgaagcaaaagatcttccagttttggcaaaatta
ttagccagtgaagaagttgggattgatcctgaaattatgggtgtttcaccgattagggcc
attcgtcagttgcttgaacgtacagatttggatattgaagatattgatatattcgaaatc
aatgaagcttttgcagcatctagcgttgctgtaaatcaagaactcaatattccagaagaa
aaagtgaatatttatggtggcgctattgctttagggcatgctatcggttcatcaggagca
cgtgttctgactactttagcttatgcgcttcaacgcgaaaataaacgttatggtattgcc
agcgtttgtattggtggcggtcttggtttggctgtcctcttggaaaaccctaatttagtt
taa

DBGET integrated database retrieval system