KEGG   Lactococcus garvieae Lg2: LCGL_1303Help
Entry
LCGL_1303         CDS       T01963                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00010  Glycolysis / Gluconeogenesis
lgv00051  Fructose and mannose metabolism
lgv00562  Inositol phosphate metabolism
lgv01100  Metabolic pathways
lgv01110  Biosynthesis of secondary metabolites
lgv01120  Microbial metabolism in diverse environments
lgv01130  Biosynthesis of antibiotics
lgv01200  Carbon metabolism
lgv01230  Biosynthesis of amino acids
Module
lgv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lgv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGL_1303
   00051 Fructose and mannose metabolism
    LCGL_1303
   00562 Inositol phosphate metabolism
    LCGL_1303
Enzymes [BR:lgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCGL_1303
Exosome [BR:lgv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCGL_1303
  Exosomal proteins of bladder cancer cells
   LCGL_1303
  Exosomal proteins of melanoma cells
   LCGL_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK60763
UniProt: F9VEL2
Position
complement(1295712..1296470)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKLNKNLKEVKEFIANIDGKLPSEDKVEVAIAAPALYLVSMVQERGNNPL
KVAAENVYFENSGAFTGEIAPAMLAAEGIEYSVIGHSERREYFHETDEDINKKAKALIAA
GVTPILCCGETLETFEAGKTAEWVSAQIEAGLAGIDGKDVANMVIAYEPIWAIGTGKTAT
AEIADETCGVVRSTVEKLYGKEVSDAVRIQYGGSVKPETVAELMSKENIDGALVGGASLE
ADSFLGLLEIYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaacctattatcgctggtaactggaaattgaataaaaacctcaaagaggtt
aaagaattcatcgctaacattgacggtaaattgccatcagaagacaaagtagaagttgca
atcgcagctcctgcactttaccttgtatcaatggtacaagaacgtggaaataacccactt
aaagttgcagctgaaaatgtttactttgaaaattcaggtgccttcactggtgaaatcgct
ccagctatgcttgcagcagaaggaatcgaatactcagtaatcggtcacagtgaacgtcgt
gagtacttccacgaaacagacgaagacatcaataaaaaagctaaagcgcttatcgcagct
ggtgtaacaccaatcctttgctgtggtgaaacacttgaaacttttgaagctggtaaaaca
gctgaatgggtttcagctcaaatcgaagctggtcttgctggtatcgacggtaaagatgtt
gcgaacatggttatcgcttacgaaccaatctgggctatcggtacaggtaaaactgcgaca
gctgaaatcgctgacgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagatgctgtacgtattcaatacggtggttctgtaaaacctgaaacagtt
gctgaacttatgtctaaagaaaatatcgacggtgccttggttggtggagcttcacttgaa
gctgattcattccttggcttgcttgaaatttacaaataa

DBGET integrated database retrieval system