KEGG   Lactococcus garvieae Lg2: LCGL_1303Help
Entry
LCGL_1303         CDS       T01963                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGL_1303
   01230 Biosynthesis of amino acids
    LCGL_1303
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGL_1303
   00051 Fructose and mannose metabolism
    LCGL_1303
   00562 Inositol phosphate metabolism
    LCGL_1303
Enzymes [BR:lgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCGL_1303
Exosome [BR:lgv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCGL_1303
  Exosomal proteins of bladder cancer cells
   LCGL_1303
  Exosomal proteins of melanoma cells
   LCGL_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295712..1296470)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKLNKNLKEVKEFIANIDGKLPSEDKVEVAIAAPALYLVSMVQERGNNPL
KVAAENVYFENSGAFTGEIAPAMLAAEGIEYSVIGHSERREYFHETDEDINKKAKALIAA
GVTPILCCGETLETFEAGKTAEWVSAQIEAGLAGIDGKDVANMVIAYEPIWAIGTGKTAT
AEIADETCGVVRSTVEKLYGKEVSDAVRIQYGGSVKPETVAELMSKENIDGALVGGASLE
ADSFLGLLEIYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaacctattatcgctggtaactggaaattgaataaaaacctcaaagaggtt
aaagaattcatcgctaacattgacggtaaattgccatcagaagacaaagtagaagttgca
atcgcagctcctgcactttaccttgtatcaatggtacaagaacgtggaaataacccactt
aaagttgcagctgaaaatgtttactttgaaaattcaggtgccttcactggtgaaatcgct
ccagctatgcttgcagcagaaggaatcgaatactcagtaatcggtcacagtgaacgtcgt
gagtacttccacgaaacagacgaagacatcaataaaaaagctaaagcgcttatcgcagct
ggtgtaacaccaatcctttgctgtggtgaaacacttgaaacttttgaagctggtaaaaca
gctgaatgggtttcagctcaaatcgaagctggtcttgctggtatcgacggtaaagatgtt
gcgaacatggttatcgcttacgaaccaatctgggctatcggtacaggtaaaactgcgaca
gctgaaatcgctgacgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagatgctgtacgtattcaatacggtggttctgtaaaacctgaaacagtt
gctgaacttatgtctaaagaaaatatcgacggtgccttggttggtggagcttcacttgaa
gctgattcattccttggcttgcttgaaatttacaaataa

DBGET integrated database retrieval system