KEGG   Lactococcus garvieae Lg2: LCGL_1352Help
Entry
LCGL_1352         CDS       T01963                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCGL_1352
   00052 Galactose metabolism
    LCGL_1352
   00500 Starch and sucrose metabolism
    LCGL_1352
   00520 Amino sugar and nucleotide sugar metabolism
    LCGL_1352
Enzymes [BR:lgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCGL_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347741..1348667
Genome map
AA seq 308 aa AA seqDB search
MIKANPKQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDIL
IVTGKAKRPIEDHFDSNIELEQNLKEKGKTELLKLVEETTDINLHFIRQSHPMGLGHAVL
QAKAFVGDEPFVVMLGDDLMNIMGDGTPLTKELISDYEKTHASTIAVMKVPHDDVDKYGV
IAPEGEVSKGLYNVAEFVEKPAVEDAPSDLAIIGRYLLTPEIFQVLEKQKPGAGNEIQLT
DAIETLNKTQRVFAHEFTGKRYDVGDKFGFVETTIEYGLNHPQIKDELHDYIIAKAKELS
KSESKTEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagcaaatccaaaacaaaaagtaagaaaagcaattattcccgcagctggtctg
ggcacacgtttccttcctgctactaaagccctagctaaagaaatgttacctattgttgat
aagccaaccattcaatttattgttgaagaagccttaaaatcaggaattgaagatatctta
atcgttacaggtaaagctaaacgtccgatcgaagaccactttgactcaaacattgagttg
gaacaaaaccttaaagaaaaagggaaaacagagcttttaaaattagttgaagaaacaaca
gatatcaatcttcacttcattcgtcaaagtcacccaatggggctcggacatgcggttcta
caagcaaaagcctttgttggtgatgaaccttttgttgtaatgctcggtgatgatctcatg
aacatcatgggggatggtacaccactcacaaaagaattgatttccgactacgaaaagaca
cacgcttcaacaatcgctgtaatgaaagttccacatgatgatgtggataaatatggtgtt
attgctccagaaggtgaagtttccaaaggtctttacaatgtcgcagaattcgttgaaaaa
cctgccgttgaggatgcgccttctgatttagctatcatcggtcgctacctcttaactcca
gaaattttccaagttttagaaaaacaaaaacctggtgcaggtaacgaaatccaattgaca
gatgcgattgaaactttaaataaaacacaacgcgtttttgcacacgagttcacaggcaaa
cgttatgatgtcggcgataaatttggttttgttgaaacaactatcgaatatggccttaat
catccccaaatcaaagatgaattgcatgattacatcatcgccaaagcaaaagaactttca
aagtctgaaagcaaaactgaaaaataa

DBGET integrated database retrieval system