KEGG   Lactococcus garvieae Lg2: LCGL_1503Help
Entry
LCGL_1503         CDS       T01963                                 

Definition
aspartate aminotransferase
Organism
lgv  Lactococcus garvieae Lg2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1477466..1478659)
Genome map
AA seq 397 aa AA seqDB search
MKKLSDFVSNIEESVTLAAAKRAKDLASQGKNIIDLTLGQPDFSTPELIGEAAIDSIHSG
KASFYTQASGLPELKSAVRNYWEKYYGYAIEDKEILVTTGAKFSLYAFFQSVLDKGDEVI
IPAPYWVSYVDQVKMSGGHPVVVSTLQENDFKITVEQLEAVKTEKTKVLLLNSPSNPTGM
IYSKEELLALGNWAVANDLLILADDIYHRLVYNKSVFTALSSLSDAIRQHTIVINGVSKT
FAMTGWRIGLAVGDSEIIAAMTKIAGQTTSNPSTVAQYAAIEAFNSDEKAVEKMRTAFED
RLNLIHPMINQIPGFEAIKPNGAFYLFPKVEKAMALKGYDNVTDFATAILEETGVALVTG
EGFGSPVHVRLSYATDLESLTEAVKRLKNWMEVAHDR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattatctgattttgtttcaaacatcgaagagtctgtgactctcgctgctgca
aagcgtgccaaagatctcgcaagccaaggaaaaaacattattgatttaactttgggacag
ccagacttttctaccccagaactcatcggggaagcagccattgattctatccattcaggc
aaagccagcttctatacgcaggcttctggtttgcctgagttgaaaagtgctgtgcgcaat
tattgggaaaaatattatggttatgccattgaagataaggaaattttggttaccacaggt
gctaaattttcgctttatgccttctttcaaagtgttttagataaaggagatgaggtcatc
attccagccccttattgggtgagttatgtggaccaagttaaaatgtcgggaggtcatcct
gttgtcgtttcgactttgcaagaaaatgactttaaaatcacagttgaacaactcgaggca
gtgaaaactgaaaagacaaaagtacttttgctgaatagcccgtccaatcccacaggaatg
atttattcaaaagaagaattattggctttgggaaattgggctgtagctaatgatctgtta
atcttagcagacgatatttaccaccgactggtttataataagagcgtgtttacagctctt
tcatctttatccgatgcgattcgtcaacatacgattgttattaatggtgtatcgaagacc
tttgcgatgaccggttggcgcattgggcttgcagttggtgacagcgaaattattgcagca
atgaccaagattgcaggtcaaacaacctcaaatccaagtacagttgctcaatatgcagcc
attgaagcttttaattctgatgagaaggcagtcgaaaaaatgcgtacagcttttgaagac
cgtctaaatttgattcatccgatgattaatcaaattcctggctttgaggccatcaaacct
aatggtgcattctatctcttccctaaagttgagaaagccatggcgctcaaaggatatgac
aatgttacggattttgcgacagcgattcttgaagaaaccggagtggcgcttgtaacggga
gaaggatttggttcacctgtacatgtaagattgagttatgccactgaccttgagagttta
acagaagctgtaaaacgtcttaagaactggatggaagtggcgcatgatagataa

DBGET integrated database retrieval system