KEGG   Lactococcus garvieae Lg2: LCGL_1657Help
Entry
LCGL_1657         CDS       T01963                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00230  Purine metabolism
lgv01100  Metabolic pathways
Module
lgv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCGL_1657
Enzymes [BR:lgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCGL_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Cupin_4 RsgA_GTPase Streptin-Immun
Motif
Other DBs
NCBI-ProteinID: BAK61117
UniProt: F9VFL6
Position
complement(1629506..1630135)
Genome map
AA seq 209 aa AA seqDB search
MPERGLLIVFSGPSGVGKGTVRAKIFENENNFDYSVSMTTRAQRPGEIDGKDYYFRTREE
FEEMIRKGEMLEYAEYVGNYYGTPLTYVNQTLDEGKDVFLEIEVQGALQVKEKVPDGVFV
FLTPPDLEELRGRLVGRGTDSAEVINNRMMKAKEEIRLMSEYDYAVVNDKVELAAERVIK
IIEAEHYRVDRVMERYAHMIEKLDEDGKN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacgtggtttattaattgtcttttctggtccttcgggagtaggaaaaggtact
gtccgtgcgaaaatttttgaaaatgaaaataactttgattactctgtatcaatgacaaca
cgtgcacaacgccctggtgaaatagatggaaaagattattatttccgtacacgtgaagag
tttgaagaaatgatacgtaaaggtgaaatgttagagtatgctgaatatgtcggcaactac
tacggcacacctttaacttatgtcaatcaaactttggatgaaggtaaggatgtatttctt
gaaatcgaagtgcaaggggccttacaagttaaggagaaagtaccagatggcgtatttgtc
ttcttgacgcctccagatttggaggagctacgtggtcgacttgttggccgtggtactgat
agcgcagaagttatcaataaccggatgatgaaagctaaagaagaaattcgcttgatgagt
gaatacgactatgctgttgtcaacgataaggttgaacttgctgcagaacgtgtcatcaag
attattgaggcagaacattatcgtgtcgatcgtgtgatggaacgttatgcacatatgatt
gagaagttagacgaagacggtaagaattaa

DBGET integrated database retrieval system