KEGG   Lactococcus garvieae Lg2: LCGL_1758Help
Entry
LCGL_1758         CDS       T01963                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGL_1758
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGL_1758
   00052 Galactose metabolism
    LCGL_1758
   00500 Starch and sucrose metabolism
    LCGL_1758
   00520 Amino sugar and nucleotide sugar metabolism
    LCGL_1758
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCGL_1758
   00524 Butirosin and neomycin biosynthesis
    LCGL_1758
Enzymes [BR:lgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCGL_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728349..1729314
Genome map
AA seq 321 aa AA seqDB search
MANKIIGIDLGGTSIKFGILTLEGEVQDKWAIPTNILSDGKHIVPDIIESINHRLNLYNL
DKSDFIGIGMGTPGTVDIEAATVRGAFNLNWADVQEVGAPISEGVGLPFILDNDANVAAL
GERWVGAGENQPDVVFITLGTGVGGGIVADGNLIHGVVGAAGEIGHIVVEPHDGFACTCG
NHGCLETVTSATGVVRLARKFAEEYEGSSPIKASIDNGDEVTSKDIFIAAEAGDAFALSV
VDKFAYYLGFACANLGSTLNPAAIVIGGGVSAAGEFLRSKVETYFQKYSFSTVRDSTKIK
LAELGNDAGIIGAASLALKFK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaaattattggtattgacctcggcggaacttctatcaagttcggtattttg
acacttgaaggtgaagttcaagacaaatgggctatcccgacaaatattctcagtgatggg
aaacatattgtccctgatatcattgaatctatcaatcaccgtttaaatctttacaaccta
gataaatctgactttattggtattggaatgggaacgcctggtacagtagatattgaagct
gctactgtccgcggtgcctttaatcttaactgggcagatgttcaagaagtcggtgcgcct
attagcgaaggtgtcggcctccccttcattcttgacaatgatgcaaatgttgcagcttta
ggtgagcgttgggtcggagctggtgaaaatcaacccgatgttgtctttatcactttagga
actggagttggcggtggtattgttgctgatggaaatctcattcacggtgttgttggcgct
gcgggtgaaattggacatatcgtggtagaaccacatgatggctttgcttgcacttgtgga
aaccatggatgcttagaaacagtcacttctgctactggcgttgtgcgccttgcaagaaaa
ttcgctgaagaatacgaaggaagcagcccaattaaagcgagcatcgacaatggtgacgaa
gtaacttcaaaagacatcttcattgccgcagaagcaggtgatgcttttgcactgagcgtt
gtggataagtttgcttattaccttggttttgcttgtgctaaccttggcagtaccctaaac
cctgccgctattgtcatcggtggtggcgtttctgctgctggagaatttctccgctctaaa
gttgaaacttatttccaaaaatattcgttctcaacagtacgtgactctacaaaaatcaaa
cttgctgagctcggtaatgatgctggtatcatcggtgccgcaagccttgctttaaaattc
aaataa

DBGET integrated database retrieval system