KEGG   Lactococcus garvieae Lg2: LCGL_1914Help
Entry
LCGL_1914         CDS       T01963                                 

Definition
DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCGL_1914
Enzymes [BR:lgv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LCGL_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1898328..1898918)
Genome map
AA seq 196 aa AA seqDB search
MYEYFKGKLVKITPTYIVVDVANIGYLINVANPYAWSHRMNQEIEIYVHQVIREDAHSLY
GFMDDAEKSLFLRLISVSGIGPKSALAIIAADDNVGLVHAIDNSDIKYLTKFPGVGKKTA
MQMVLDLAGKFDATASAEMVKTAAQNENLALIEAIEALQALGYKATELKKIQKKLEAESG
LTSEEYIKAALKLMMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatacttcaaaggtaagttagttaaaattacaccaacatatatcgttgttgat
gtcgccaatattggttacctcatcaatgtagcaaatccctatgcttggtcccataggatg
aatcaagagattgaaatatatgtgcaccaagtgattagggaagatgcacatagcttatat
ggctttatggatgatgcagagaaatctttgtttttacgtttgattagtgtctcaggcatt
ggtccaaaatctgccttagcaatcattgctgcagatgataacgtgggtcttgttcatgcg
atcgacaatagtgacattaagtatttgacgaaatttccaggtgtcggtaaaaaaacagcg
atgcagatggttctggatttagctggtaaatttgatgccacagcttcagctgaaatggtc
aaaactgcggctcaaaatgaaaacctagctcttattgaagcgattgaagctttgcaagcc
ttaggctataaagcaactgaacttaagaaaattcagaagaaacttgaagctgaatctgga
ttgaccagtgaagagtatattaaggccgctctcaaattaatgatgaaataa

DBGET integrated database retrieval system