KEGG   Lysinibacillus sp. GY32: T479_12805Help
Entry
T479_12805        CDS       T03062                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lgy  Lysinibacillus sp. GY32
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T479_12805
   00650 Butanoate metabolism
    T479_12805
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    T479_12805
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T479_12805
Enzymes [BR:lgy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     T479_12805
Amino acid related enzymes [BR:lgy01007]
 Aminotransferase (transaminase)
  Class III
   T479_12805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2581103..2582461)
Genome map
AA seq 452 aa AA seqDB search
MDKNIEVLRTEGDINLTKTRSVWQENHLSKESFEFINDDAKYYLHQSLSTPCLNIIEKSY
GIYIEDIDGRKYMDFHGNNVHQIGYGNEYVIRAVKEQLDTLPFSPRRYTNKVAIQLAKKL
VDIAPEPLNKVLLAPGGTSAVGMALKLVRKATGKFKTISMWDSFHGASLDAISVGGEALF
RNGMGPLMPGSLHIAPYNSYRGLFDDDNGRFKSLDYLEYILERENEIGAIILEPVRCTDV
HIPPKEYYQRLRNICDSNNILMIFDEIPTALGRTGKMFTFENFGVIPDIVLLGKGLGGGV
FPMAAMLVKGELDVAQDIALGHYTHEKSSLGCAAALATLHYIEDFKLIEKANQLGEYMRI
RLEKMQEQYEIIGDVRGIGLLYGVELVLDRHSKEKAIVEAEQVMYKCMEKGLSFKVSQEN
VLTLTPPLIIKEQELELAMDILDQSIQEVLEQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaacattgaagttttaagaacagagggggatattaatttaacaaaaactcgt
tctgtctggcaagaaaatcatttaagtaaagaatcttttgagtttataaacgatgatgcc
aagtattatttacatcagtctctttctactccttgtttaaatattatagaaaaaagctat
ggcatttacatagaggatatagacggaaggaagtatatggattttcatgggaataatgtt
catcaaataggatatgggaatgagtatgttattcgtgccgtaaaagagcagttggataca
cttccattctcaccaagacgttatacaaataaagttgcaatccagttagcaaaaaaatta
gttgatattgcaccagaacctttaaataaggtacttttggctcctggaggaacttcagct
gttggtatggctttaaagcttgttcgaaaggcaacaggtaaatttaaaacgatatcgatg
tgggattcgtttcacggcgcctctttagacgcgatttcagttggaggagaagcgcttttc
cgtaacggtatgggcccattaatgccagggagtctacatatagcgccttacaattcatat
cgcggtttgtttgatgatgacaatggtaggtttaaatcccttgattatctagagtatata
ctagaaagagaaaatgaaatcggtgccattattttagagcctgttcgttgtacagacgtg
catatcccaccaaaagagtactatcaacgtttacgcaatatttgtgatagcaataatata
ttaatgatttttgatgaaattccaactgctttaggacgaacaggaaaaatgttcactttt
gaaaactttggagttattccagatattgttttattgggaaaaggattgggtggaggcgtg
tttccgatggcggcgatgctcgtaaaaggagaacttgatgttgcccaagatattgcactt
ggtcattatacgcatgaaaaaagttcgctaggctgtgcagcagcattggctactcttcat
tatattgaggattttaaattaatagaaaaggctaatcaattaggagagtatatgagaata
cgacttgaaaagatgcaagagcagtatgaaattataggtgatgtacgaggaatcggtctt
ttatatggcgtagaactagtattggatcgccattcgaaagaaaaagctatagtcgaagca
gaacaagtaatgtataaatgtatggagaagggattaagttttaaagtatcacaagaaaat
gtgcttacactcacgccaccactgattattaaggaacaagaattagagctggcaatggat
attttagaccaatctatccaagaggttttagagcagtaa

DBGET integrated database retrieval system