KEGG   Lactobacillus helveticus DPC 4571: lhv_0028Help
Entry
lhv_0028          CDS       T00625                                 

Definition
Type III restriction-modification system restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lhe  Lactobacillus helveticus DPC 4571
Brite
Enzymes [BR:lhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     lhv_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30519..33530
Genome map
AA seq 1003 aa AA seqDB search
MKINYEKLDYQENAVKAVINTLSNHDETATKLILNSDYLDNSVRETLLNNGQKYPGSGYL
NPFPQFNIEMETGTGKTMVYLQTIMALHKRFHENKFIIVVPSRAIKAGVEDNLKKVQVYL
SDIYNTDKYHYFVYDSKQIAQLQSFEGNGFEIMLTTIQAFNKNTNVINQEYNEGFFGGKP
LDQIREANPIVIIDEPQSVDSAKAGKKAIASLNPKLALRYSATHKEKQYPMLYEYGPVQA
YKDRMVKHIETLGTEVNTNGNIPFIELKEQPEFKNGRLQAKVLAYKQVKDDFLKRTVTLK
KGDSLAEKAKNPRYERLGKVTAIDSGNNFIEFENGYHAEVGALEGENDIWVSAQMEALVR
DHLDRELRMQDQGIKVLSLIFLDQVKNYRIYTKDGYEKGIYAKLFERIYEKVLHSDPKYK
KLNDYNVPVAEVHDGYFAQDRATRNKPAMYRDTKGDTTKDETAYGAIMDDKEGLLTKYIP
GKPETNTKAAKLRFIFSHSALKEGWDNPNVFQILTIATPKNDLTRRQKIGRGLRIPVNQE
GKRVYNENQNIVTIYANETFEEFAAGLQNEYLEDGLLSNRIDEDFFTNMVVSKSVTNTED
VLTNKKEEKEIENVNEEKSTTDKTRKVTHHESVTFANVLKQNNIINNNSKPTARGLNSLS
NNTIKKKIVDQSVSEGIEAATAKRMMSIVFDRFNVPKPRDRRDRTTVQLIDKNNSYFNAL
WNKISYKVRYHIKFNEDELINAIVNGNNPLKDIKITRMTAVQTRARVDLNTTNVKDRVIS
QNTEHLTWNDMPIMDVTRQLADKTGLTRKAIIKMILLTKKKDSSFIKKIKMNPALFVNRA
YQRIRMHEQNLLSHSLVYIQTGEKWSKDLFKPFDASDNTLWKVPERGLKKTLFDKIPTQS
QEERKFAESLVNEEKIKYFFKLPNWFKIPTPFGNYNPDWAILAETNGIEKLYFVIDTKTT
EEKGTLRSGEQTKLNAGAQAYKAEGFEDVRFEAPIKVIGDLDL
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaattacgaaaaactagattatcaagaaaatgcagttaaggctgtaattaat
acattgtctaatcatgatgaaactgcaactaaattaattttaaactctgattatttagat
aattctgtacgtgaaacattgttaaataatggacaaaaatatcctggttcaggttatctt
aatcctttcccacagtttaatattgaaatggaaactggaacaggtaaaacaatggtttac
ttacaaacaattatggcactgcataagcgctttcatgaaaataaatttataattgttgtt
cctagtcgagcaattaaagcaggggtagaggataacctgaaaaaagtccaagtttattta
agcgacatctataacacagataaatatcattattttgtttatgattctaaacaaattgca
caactgcaaagttttgaaggcaatggcttcgaaataatgctaactactattcaggctttt
aataaaaatactaatgtaattaaccaggaatataatgaaggcttttttggtggaaagcca
ttagatcaaattagagaagcaaatcctatagttattatcgatgaaccacagtctgttgat
agtgctaaagcagggaaaaaagctattgcatccttaaatcctaaattggcactgcgatat
tcggcaacacacaaagagaagcaatatccaatgctttatgaatatggtccagttcaggca
tataaggatcgcatggtaaagcatattgaaactctgggcacagaagtaaacacaaatgga
aatattccatttatcgaattaaaagagcaacctgaatttaaaaatggtagattacaagca
aaagtacttgcttataagcaagtaaaagatgattttttaaaacgtactgttactttgaaa
aaaggtgattcattagctgaaaaagctaaaaatcctcgatatgaaagattaggtaaggtt
actgcaatagattcaggcaataactttattgaatttgagaatgggtatcatgctgaagta
ggtgcacttgaaggtgaaaatgatatctgggttagtgcccaaatggaagctttagtcaga
gatcatttagatcgtgaactgagaatgcaagatcagggtatcaaggtattatcgcttata
tttcttgatcaagttaaaaattatcgtatttatacgaaagatggctatgagaaaggtata
tatgccaaactttttgaaagaatatatgaaaaagttttgcatagcgatccaaaatataaa
aaattaaatgactataatgttccagttgctgaagtacatgatggttattttgctcaggat
agagcaactagaaataaaccggcaatgtatcgtgataccaaaggcgatactactaaggat
gaaactgcttatggtgcaataatggatgataaagaggggctactaacaaaatatatacct
ggaaagccggaaacaaatactaaagcagcaaaactgcgatttatttttagccattcagct
ttaaaagaaggttgggataatcctaatgtatttcagattttgactattgctacaccgaaa
aatgatctaacaagaagacagaaaattggtcgtggattgcgtataccggttaatcaagaa
ggtaagcgagtttataacgaaaatcaaaatatagttactatatatgctaatgagactttt
gaagaattcgctgctggacttcaaaatgaatatttagaggatggattactttcaaacaga
attgatgaagacttttttacgaatatggttgtctctaagagtgtaactaatacagaagat
gtattgactaataaaaaagaagaaaaagaaattgaaaatgtaaatgaagaaaagtcgaca
actgataaaacaagaaaagtaactcatcatgaatcagttacttttgcaaatgtgttaaaa
caaaataatataattaacaataatagtaaaccaacagcccgaggattaaattcattgagc
aataatactattaaaaagaaaatagtagatcaaagtgttagtgagggtattgaggctgca
accgcgaaaagaatgatgagtatagtctttgatcgttttaatgttcctaaacctagagat
agacgagaccgtacgacagttcaactcattgataaaaataatagttattttaatgcactt
tggaataaaatttcttataaagttagatatcatatcaaatttaatgaagatgaattgatt
aatgctattgtaaatggaaataatcctttaaaggatattaaaataactagaatgacggcg
gttcaaacaagagctagagtagatttgaatactactaatgtaaaagatagagttattagt
cagaatactgaacatctaacatggaatgatatgcctattatggatgtaactagacaactt
gcagataaaacaggtttaactagaaaagctattataaaaatgattttgttaactaagaaa
aaagatagtagctttattaagaaaataaagatgaacccagctttgtttgttaacagagca
tatcaaaggattcggatgcatgagcaaaatcttttgagtcattctttagtttatattcaa
acaggtgaaaaatggtctaaggatttatttaagccatttgatgcatcggataatactttg
tggaaagtacctgaacgaggattaaagaaaactttatttgataaaattccaactcaatct
caagaagaaagaaaatttgcggaatcattagtaaacgaagagaaaataaagtatttcttt
aaattgccaaattggtttaagataccaactccatttggtaattacaatcctgattgggct
attcttgcagaaacaaatgggatagagaaactttattttgttatagacacgaagactaca
gaagagaaaggtactttaagaagtggtgagcagactaaattaaatgcaggtgctcaggct
tataaagcagaagggtttgaggatgtgagatttgaagctcctattaaggtgattggagat
ttagatttgtaa

DBGET integrated database retrieval system