KEGG   Lactobacillus helveticus DPC 4571: lhv_0047Help
Entry
lhv_0047          CDS       T00625                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lhv_0047
   01230 Biosynthesis of amino acids
    lhv_0047
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0047
  Energy metabolism
   00680 Methane metabolism
    lhv_0047
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lhv_0047
Enzymes [BR:lhe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     lhv_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51693..52322)
Genome map
AA seq 209 aa AA seqDB search
MTDFYFVRHGQTAANAAGLKQGTINTKITFLTETGKKQAQTVHKHFDISFADRIVASPLQ
RTKDTADILNQSAHLPITYDKLLLEISYGNWDGSKNADLEAKYPQVFDHVLNDVLPSYAQ
LAHGETFTHVIDRADHFMSVTAQRYPDEKIIVVTHGFTIKAAVLAALGRPDNPMVVEEPD
NLSITRITRKASSDNYYLRYYNRVVDSKF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttattttgttcgtcatggtcaaacagcggccaacgctgccggtttaaag
cagggaacaattaatactaaaattacttttttaacggaaaccggaaagaagcaagcacaa
acggtgcacaaacattttgatatatcgtttgcggacagaattgtggcaagcccactacag
cggacaaaagacactgctgacattctaaatcagagcgcgcacctaccgataacttatgac
aaactgcttctcgaaatatcgtacgggaattgggatggctctaaaaatgcggatctggaa
gctaaatatcctcaggtttttgaccatgttttaaatgatgtgttgccaagttacgcgcaa
cttgctcatggtgaaacgttcacgcatgtaattgaccgggctgatcattttatgtctgtt
acggcgcaacggtatccggatgaaaaaatcattgtggtaacgcacggtttcacgattaag
gcggcggtcttggcagcgctgggacgccctgacaatccgatggtcgttgaagaacccgat
aacttaagcattaccagaattacccgaaaggcaagtagtgataattactatttgcgttat
tataaccgggtagttgattcaaaattctaa

DBGET integrated database retrieval system