KEGG   Lactobacillus helveticus DPC 4571: lhv_0164Help
Entry
lhv_0164          CDS       T00625                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lhv_0164
Enzymes [BR:lhe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     lhv_0164
Peptidases [BR:lhe01002]
 Cysteine Peptidases
  Family C44
   lhv_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164609..166558
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPKINEKQAVIGKMMATIKHRGPGSDGYYTNDEVALGFRRLSIIDLRGGSQP
IYNEDKTRAIIFNGEIYNFKPLREELIKAGHVFSTKADTEVLLHGYEEWGMDGLLKRVRG
MFAFLIWDDNNKTLYGARDFFGIKPMYYSNQNGHLLVGSELKSFLEFPKFKRELNVEAVK
PYLMNQYNDLEETFFKGVYRFPAGHWFEYKDGEMKTHQYWDAEYKENSLSFEETLKRIND
DLKETVDLYRNADVKVGAFLSEGIDSSYLTTLLNPDDVFSVSFDDSTYDEASKAKALADI
NHWTFFSDKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNDIIKVFTSELKKLPKKKQVKLAHKIKKMPNFPGKVHMYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANSILQPTYRNKLTVNGIYQKDFKKVKNIDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLEVRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPDEWAKRPKLGFPTPIKQWLKEPRFYKQVRSLFEEEFVNDIFDQKKIIKLLDDNYEG
DGSHRRQIWVIYTFLVWYKLFFVDYENTVKKYQHVQPEVANLISQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgcattttatgatccaaaaataaatgaaaaacaagctgtcattggt
aagatgatggcgacgatcaagcaccgtggacctggttccgacggttattacactaatgat
gaagttgcacttggctttagaagattatcaattatcgatcttcgaggcggaagtcaacca
atttataatgaagataaaactagagcaatcatctttaatggtgaaatttacaactttaag
ccattaagagaagaattaattaaagctggacacgttttttcaactaaagcagatactgaa
gttcttcttcatggatatgaagaatggggcatggatggccttcttaagcgtgtacgcgga
atgtttgctttccttatttgggatgacaacaacaagaccctttatggtgcacgtgacttc
tttggtattaagccaatgtattacagcaaccaaaatggccacttgctagttggctcagaa
cttaagagtttcttggaatttccaaagttcaagcgtgaattaaacgtagaagctgttaag
ccatacttaatgaaccaatataatgaccttgaagaaaccttctttaagggcgtttaccgt
tttccagctgggcactggttcgaatacaaagatggtgaaatgaagacccatcaatattgg
gatgccgaatataaagaaaacagcttaagctttgaagaaactttaaagcgaatcaacgat
gatttaaaggaaactgttgatttatacagaaacgctgatgttaaggttggtgcattctta
tctgaaggtatcgactcatcatacttgactactttgcttaatccagatgatgttttctct
gtcagctttgatgattcaacttacgatgaagcttcaaaggctaaggccttagctgatatc
aatcactggactttctttagtgacaaggtagacgctgatgaagctatgcgtgacttccca
gaaatgcaataccacatggatgaacctgatgccaacccatcaatcattcctctctggtac
ttgtgtaagttagctcgtaagcacgttactgttgctctttctggtgaaggtgccgatgaa
ttgtttgctggttacgtaaactacgggatgcacactcacaatgacatcattaaggtcttt
actagtgagttaaagaaattgcctaagaagaagcaagtgaagttagctcataagattaag
aagatgcctaacttcccaggtaaggttcacatgtatactaatttggctgaaccaagtgaa
ttttatgtaggtcaatcagtcatctatgacatggattacccaactatctttacttctaag
gatgctaatagtattttgcagccaacttaccgcaataaattgactgttaatggcatttac
caaaaggacttcaagaaggttaagaacatcgataacgttaagcaaatgcaatacattgat
ttgcaccactttatgcttaatgatatcgaacaaaaggctgataagatttcaatggctcac
tcacttgaagttcgtgtgccatatcttgataagaagattgcagaacttgctaactctatt
ccaactaagtacttagttaaccgtcatgatactaagtatgctttgcgtaaagcttcagaa
aaagtcttgccagatgaatgggctaagcgtccaaagcttggattcccaacaccaatcaag
caatggcttaaggaaccacgtttctacaagcaagttcgtagtttgtttgaagaagaattc
gttaatgatatctttgaccaaaagaagattattaagttgcttgatgataactacgaaggt
gacggctcgcacagaagacaaatctgggttatctacaccttccttgtttggtacaagttg
ttctttgttgattacgaaaatactgttaaaaaataccaacatgttcaacctgaagttgct
aatttaatttcacaaggcaaattactataa

DBGET integrated database retrieval system