KEGG   Lactobacillus helveticus DPC 4571: lhv_0201Help
Entry
lhv_0201          CDS       T00625                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lhv_0201 (gpmA)
   01230 Biosynthesis of amino acids
    lhv_0201 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0201 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    lhv_0201 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lhv_0201 (gpmA)
Enzymes [BR:lhe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lhv_0201 (gpmA)
Exosome [BR:lhe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lhv_0201 (gpmA)
  Exosomal proteins of melanoma cells
   lhv_0201 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201307..201999
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDENLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaatccgtcacggacaaagtgaatggaacctttcaaaccaattt
actggttgggttgatgttaacctttcagaaaaaggtgttgaagaagctaagaaagctggt
cgtttaatcaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gccatcaagactttgcacttcgcattggaagaaagtggtcaactctggattccagaaatg
aagacttggagacttaacgaacgtcactacggtgctcttcaaggtttgaacaagaaggat
actgctgaaaagtacggcgatgaacaagttcacatttggcgtcgttcatacgatgtattg
ccaccagctattgatgatgacaatgaattcagtcaagcacatgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacttacacgtatgtcttgaccgtgtaatg
ccattctgggaagatcacattgctccagacttacttgacggcaagaacgtaattatcgca
gctcacggtaactcacttcgtgctttgactaagtacatcgaaaacatttctgacgacgac
atcatgaacctcgaaatgaagactggtgaaccagttgtttacacattcgacgaaaacttg
gatgttgttaacaaggaaaagttggacgactaa

DBGET integrated database retrieval system