KEGG   Lactobacillus helveticus DPC 4571: lhv_0248Help
Entry
lhv_0248          CDS       T00625                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lhe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lhe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252685..253980
Genome map
AA seq 431 aa AA seqDB search
MKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVANLMDLLSEM
DVHCDFGETTLRIDPENIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMPSVGATMNIIMASVTAQG
QTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVDMLKAQIPHTIIPDRIEAGT
YVSLAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDADEDSLYVYPAGELKMVQVKTNV
YPGFATDLQQPITPLLLTAKSGEGIVIDNIYPKRNGHIPQLQKMGADIKVEDNIILAHPT
KQLHGAEVTAGEIRAGACLMIAGLMASGTTVIDKAGNILRGYDRVQEKLRQLGADVTIKD
DPSEPGILDNI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagatgattattcatggtggaaagcctctacaaggtgatgtttggattggtggc
gccaagaactctacagttgcgctcattccagcatcgattttgtcaagaacaccagtaact
ttggaaggcgtcccaaggattgctgatgttgccaacttaatggatttattaagcgagatg
gatgtacattgtgattttggagaaactacattacgtattgatccagaaaatatcaagatg
agtccattaccagctggtaagattaagagtttgcgtgcatcgtattacttcatgggtgca
cttcttggtcgttttggcaaggcagtagtaggcttccctggtggtgacgatattgggcca
cgtcctattgaccaacatattaagggctttgaagccttaggcgccagtgtaaagaatgaa
aatgatcaaattataattacagcaccagaagatggattgcatggggcaaaaattcatttg
aaaatgccatctgttggtgcaacgatgaatattattatggccagtgtaactgcgcagggt
caaactattattgaaaatgcagctaaagaaccagaaattattgatttagccaccttttta
aacaatatgggtgcagtaattcgtggtgccggaactgattcaatcagaattgaaggtgtg
gatatgcttaaagcacagattccacatacaattattcctgatcgtattgaagcaggtact
tatgtttctttggccgcttgcattggtaatggtattcgtattcataatattattgaagaa
cacctagattcttacttagctaaagtagaagaaatgggtgtagtaattgacgcagatgaa
gattcactttatgtttacccagcaggggaattaaagatggttcaggtgaagaccaatgtg
tatcctggctttgccactgaccttcaacaaccaattaccccacttcttttaactgctaaa
tcaggtgaaggcatagtaattgataatatttatccaaaacgtaacggtcacatcccacaa
ttacaaaagatgggggctgatattaaggttgaggataatattattttggctcatccaact
aagcaacttcatggtgcagaagtaactgctggtgaaattagggcaggagcttgcttgatg
attgctggattaatggcaagtggtaccactgtaattgataaagctggcaatattttgcgc
gggtatgatcgtgtacaagagaagcttcgtcaacttggagctgatgtcacaattaaagat
gatccaagtgaacctggtatattagacaatatctag

DBGET integrated database retrieval system