KEGG   Lactobacillus helveticus DPC 4571: lhv_0354Help
Entry
lhv_0354          CDS       T00625                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00010  Glycolysis / Gluconeogenesis
lhe00260  Glycine, serine and threonine metabolism
lhe00680  Methane metabolism
lhe01100  Metabolic pathways
lhe01110  Biosynthesis of secondary metabolites
lhe01120  Microbial metabolism in diverse environments
lhe01130  Biosynthesis of antibiotics
lhe01200  Carbon metabolism
lhe01230  Biosynthesis of amino acids
Module
lhe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0354
  Energy metabolism
   00680 Methane metabolism
    lhv_0354
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lhv_0354
Enzymes [BR:lhe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lhv_0354
Membrane trafficking [BR:lhe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    lhv_0354
Exosome [BR:lhe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lhv_0354
  Exosomal proteins of melanoma cells
   lhv_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ABX26576
UniProt: A8YTC0
Position
349875..350555
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEQQAKKAGELINTISDFAPTHIHTSVLS
RAIVTANIVAETCNLLWLPMTKTWRLNERHYGALRGLNKDTSRKVFGVEQVLLWRRSFDS
VPPKQGSPVIDRRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINNHDIVNLEVPNAEPIVYTMDEQLNIVKKEILRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattggttcgacacggtgaaagtgttgctaatgccgcaaatgtttat
acgggctggaatgatgtgccgttaaccaaaaaaggtgagcaacaagctaaaaaagcaggt
gaattgattaatactatttctgattttgcaccaacgcatattcatacttctgttttgtcg
cgtgctattgtaacagccaatatcgtagctgagacgtgcaatctcttatggctacctatg
actaagacgtggcgtttaaatgaacggcattatggcgccttaagaggccttaacaaggat
acctcacgtaaagtctttggcgtagagcaagttttattatggcggcgcagttttgactct
gttccgccaaagcaaggctcgccagttatcgatcgacgttataagttgtgtgatcaacat
ttaatgccgcgtgcggagagtttgcatcaaacacaaaagcgactaatgccatattattat
gatcacattgcttcaagattgcttaatggtgaggatcaattaatagtagctcatggttca
agtttgcgagctttaattaaaaaattagaaaatattaacaatcacgatattgtaaacttg
gaagtgcctaacgcagaaccaattgtttatactatggatgagcagttaaatattgttaaa
aaagaaatactgaggagttaa

DBGET integrated database retrieval system