KEGG   Lactobacillus helveticus DPC 4571: lhv_0354Help
Entry
lhv_0354          CDS       T00625                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lhv_0354
   01230 Biosynthesis of amino acids
    lhv_0354
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0354
  Energy metabolism
   00680 Methane metabolism
    lhv_0354
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lhv_0354
Enzymes [BR:lhe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lhv_0354
Exosome [BR:lhe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lhv_0354
  Exosomal proteins of melanoma cells
   lhv_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349875..350555
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEQQAKKAGELINTISDFAPTHIHTSVLS
RAIVTANIVAETCNLLWLPMTKTWRLNERHYGALRGLNKDTSRKVFGVEQVLLWRRSFDS
VPPKQGSPVIDRRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINNHDIVNLEVPNAEPIVYTMDEQLNIVKKEILRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattggttcgacacggtgaaagtgttgctaatgccgcaaatgtttat
acgggctggaatgatgtgccgttaaccaaaaaaggtgagcaacaagctaaaaaagcaggt
gaattgattaatactatttctgattttgcaccaacgcatattcatacttctgttttgtcg
cgtgctattgtaacagccaatatcgtagctgagacgtgcaatctcttatggctacctatg
actaagacgtggcgtttaaatgaacggcattatggcgccttaagaggccttaacaaggat
acctcacgtaaagtctttggcgtagagcaagttttattatggcggcgcagttttgactct
gttccgccaaagcaaggctcgccagttatcgatcgacgttataagttgtgtgatcaacat
ttaatgccgcgtgcggagagtttgcatcaaacacaaaagcgactaatgccatattattat
gatcacattgcttcaagattgcttaatggtgaggatcaattaatagtagctcatggttca
agtttgcgagctttaattaaaaaattagaaaatattaacaatcacgatattgtaaacttg
gaagtgcctaacgcagaaccaattgtttatactatggatgagcagttaaatattgttaaa
aaagaaatactgaggagttaa

DBGET integrated database retrieval system