KEGG   Lactobacillus helveticus DPC 4571: lhv_0402Help
Entry
lhv_0402          CDS       T00625                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lhv_0402 (recR)
DNA repair and recombination proteins [BR:lhe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lhv_0402 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
391067..391666
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMRLPGVGEKTATRLAFYTMDMPEKDVEDFSKALIQVKNDIHQCPIC
GNITEKEVCDICSNPNRDQTTIMVVEQPKDLMAFEEMGEYDGLYHVLHGVLSPMDGIGPE
EINIKSLITRLQKNDDVKEVILALNSTPEGESTAMYISKLIKPAEIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaatagcccatttgattgatgcttatatgaggctgcctggagta
ggtgaaaaaacagccactcgtttggctttttatacaatggatatgcccgaaaaggatgtt
gaagatttttcaaaggctttaattcaagtgaagaatgatattcatcaatgtcctatttgt
ggaaatattactgaaaaagaggtctgtgatatttgttccaatcctaatcgtgatcaaaca
actatcatggttgttgaacaaccaaaggatttgatggcttttgaagagatgggcgaatat
gatggcctatatcatgtgcttcacggcgtcctttcaccaatggacggaattggaccagaa
gagattaatattaagtcattaattactcgtttacaaaaaaatgatgatgtaaaagaagta
attttagctcttaactcaactccagaaggtgaatctactgctatgtatattagcaagttg
attaagccagccgaaattaaggtaactcgtttagcagctggcttgtctgtgggcagtgat
attgaatatgctaattccattactttaaagcgagcagtgcaagggagaacggcattataa

DBGET integrated database retrieval system