KEGG   Lactobacillus helveticus DPC 4571: lhv_0429Help
Entry
lhv_0429          CDS       T00625                                 

Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lhv_0429
Enzymes [BR:lhe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lhv_0429
DNA repair and recombination proteins [BR:lhe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     lhv_0429
    RecFOR pathway proteins
     lhv_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
414662..415252
Genome map
AA seq 196 aa AA seqDB search
MYEYFEGIVTVITPSYIVVDVNGVGYKVYSPTPFAYQKGDKAKIFIEQVVRDTGITLYGF
QSEDDKGLFLKLLSVSGIGPKSALAIMAAEDANSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLRDYVARLDRQDEEQGNISPALNDALLALIALGYTQKEVDRITTKLEEVNAD
TADQYIKKGLALLLKK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatattttgaaggaatagttacagtcattacgcctagttatatcgtagttgat
gtaaatggtgtaggttataaggtatatagtccaactcctttcgcctatcaaaagggagat
aaagctaaaatctttattgaacaagttgtaagagatacgggaattaccttgtatggtttt
caaagcgaagatgacaaggggctctttcttaagctgttaagcgttagtgggatcggccct
aaaagcgcattggctatcatggcagctgaagatgccaattctttggccgaagcaattgag
cagggagaagttaagtatcttactcgtttccctggtgtgggtaaaaaaacggcttctcag
attgtgcttgatttgaagggcaagctacgcgattatgttgctcgacttgatcgtcaagat
gaagaacaaggaaatatctcaccagcattgaatgatgccttgttagcgttgattgccttg
ggttatacccaaaaagaagtagatcgaattactactaagcttgaagaagttaatgcggat
acagccgatcagtatattaaaaaaggcttggcattactgcttaagaagtag

DBGET integrated database retrieval system