KEGG   Lactobacillus helveticus DPC 4571: lhv_0611Help
Entry
lhv_0611          CDS       T00625                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lhv_0611
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     lhv_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598776..599702
Genome map
AA seq 308 aa AA seqDB search
MKKIVVIGSSNVDTTLHVKDFPKPGETINATEITSAGGGKGANQAIAAAKSGAETYFINR
VGEDSEGGYITHQLKSYGVDTTYVQTTMGSKTGHAYITLKEAGQNDIIIDHGANYELTVE
DIQAASDLFKDVDCVIAQFETPLEVTIEAFKLAKKSGKITILNPAPAIDKIPKELLQYTD
IITPNETESDKITGIQIKDNSTLATNAEKLHLLGVKNVVITYGDKGAYISSADIETLVPA
YKVEATDTTGAGDTFIGYLASNLKPDLSNFEAAAKIANRASSIAVQRLGAQPSIPTAKEV
EEAMEDNE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtagttattggttcaagcaatgtagatactacattgcacgtaaaggac
tttccaaaaccaggtgaaacgattaacgccacagaaataacttctgctggtggtggtaaa
ggtgcaaaccaagccatcgccgcagctaaaagtggtgcggagacttattttattaatcgt
gtcggtgaagacagcgaaggtggttatatcacccatcaattgaagagttatggcgttgac
actacctatgttcaaactacgatgggaagcaagactggtcatgcttatattacattaaaa
gaagcaggacaaaatgatattattatcgatcatggcgctaactatgaattgaccgttgaa
gacattcaggctgctagtgatttgtttaaagatgttgactgtgttattgcccaattcgaa
acgccacttgaagtaacaattgaggctttcaagttagctaaaaagtcaggaaaaatcaca
attttaaatcctgctcctgctattgataagattccaaaagagttgttgcaatacacagat
attattacgccaaatgaaactgaaagtgacaaaattacgggcatccaaataaaggacaat
tcaactttggcaacgaatgctgaaaagttgcatcttcttggcgttaaaaacgtagtaatt
acatacggtgataaaggtgcatatatttcatctgcagatattgaaaccttagttccagct
tataaagttgaagcaactgataccactggtgcaggcgatacctttattggttatttagca
agcaacttaaagccagacttatctaattttgaagcagctgccaagattgctaatcgtgcc
tcatcaattgcagttcaacgcttgggtgctcaaccttcaattcctactgccaaggaagta
gaagaagccatggaggataatgaataa

DBGET integrated database retrieval system