KEGG   Lactobacillus helveticus DPC 4571: lhv_0629Help
Entry
lhv_0629          CDS       T00625                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lhv_0629
Enzymes [BR:lhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     lhv_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
615147..617546
Genome map
AA seq 799 aa AA seqDB search
MPVDYDSKDYLKSVDAYWRAANYLSVGQLFLMKNPLLRHKLVAEDVKPKPIGHWGTIAPQ
NFIYAHLNRVLKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTERYPEITQDEKGMAKLFK
RFSFPGGVASHAAPETPGSIHEGGELGYALSHGVGAILDNPDVIATVEIGDGEAETGPLA
ASWFSDKFINPIKEGAVLPILQINGFKISNPTIVSRMSDQELTEYFRGMGWDPHFVSVFK
GGRFDGEKDPMQVHEEMAKTMDEVIEEIKAIQKHARENNDATLPHWPLIIFQCPKGWTGP
KKDLDGNPIENSFRAHQIPIPVSQSDMKHADMLVDWLESYKPDELFNEDGSPKEIVLENT
AKGDHRMAMNPITNGGIDPKRLNLPDYRDFALKFDKPGSVEAQDMVEWAKYLNEVAKLNP
TTFRGFGPDESKSNRLFKLLDDQKRQWEAEIHEPNDENLAPSGRVIDSQLSEHQDEGFLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQYWRHDYPSLNFVATSTVFQQDH
NGYTHQDPGILTHLFEKNRPDLVHEYLPSDTNTLLAVGNKALQDRECINVLVTSKQPRPQ
WFSIEEAQKLVDHGLGYVDWASTDKSAKPDVVFASTETEPTMETLAAIDILHDKFPDLKI
RYINVVDVMKLMSPKDNKNALSDEEFDRLFPKDVPVIFAWHGYKTMMESIWFARNRHNVH
IHCYEENGDITTPFDMRVLNHLDRFDLAKDAVESVEKLKGKHADFISHMDDLLEKHHQYI
RDYGKDMPEVTEWKWKGLK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgattacgattctaaagactatttaaagagcgttgatgcttattggcgcgca
gccaactacttatcagttggtcagttgttcttaatgaaaaacccacttttgagacacaaa
ttagttgcggaagatgttaaacccaagccaattggtcactggggcacgattgcaccacaa
aacttcatttatgcccacttgaaccgggtacttaagaaatatgatttgaatatgttttac
attgaaggttctggtcatggcggtcaggtaatggtttctaattcataccttgatggttca
tacactgaacgttatccagaaatcactcaagatgaaaagggtatggctaagttgttcaag
cgtttcagtttcccaggtggtgttgcttcacacgctgctcctgaaactccaggttcaatc
cacgaaggtggggaattaggttatgcattgtctcacggtgtaggtgcaattttggataat
ccagatgttattgccacagttgaaattggtgacggtgaagccgaaactggtccacttgct
gcatcttggtttagtgacaagtttattaacccaattaaagagggtgcagtattgccaatc
ttgcaaatcaacggcttcaagatttccaacccaacgatcgtttccagaatgagcgatcaa
gaattgactgaatacttccgcggtatgggttgggacccacacttcgtttcagtctttaag
ggcggccgtttcgatggtgaaaaggatccaatgcaagttcatgaagaaatggctaagaca
atggatgaagtcattgaagagattaaggctattcaaaagcacgcccgtgaaaataatgat
gctaccttgccacattggccattaattatcttccaatgtccaaagggttggactggtcct
aagaaggatcttgatggtaatccaattgaaaactcatttagagctcaccaaattcctatt
cctgtatctcaaagcgacatgaagcatgcagatatgctggttgattggcttgaaagctac
aagcctgatgaattattcaatgaagatggttcaccaaaggaaatcgtccttgaaaacact
gctaagggtgaccaccgtatggctatgaatccaatcactaacggtggaattgaccctaag
cgtttgaacttgccagattatcgcgactttgccttgaagtttgataagccaggctctgtt
gaagcacaagacatggtagaatgggctaagtacttaaatgaagtagccaagctcaaccca
actactttccgtggctttggtccagacgaatctaagtctaaccgtttgtttaaacttctt
gatgatcaaaagcgtcaatgggaagcagagattcatgaaccaaatgatgaaaacttggct
ccaagtggtcgagtaattgattcacaattatcagaacaccaagacgaaggcttccttgaa
ggttatgtcttgactggtcgtcacggattcttcgcaacctatgaagcatttggccgtgta
gttgattcaatgcttacccaacatatgaagtggctcagaaaagctaaggaacaatactgg
cgtcatgattatccatcacttaactttgtagcaacttcaactgtattccaacaggatcac
aacggttacactcaccaagatccaggtattttaactcacttgtttgaaaagaatcgtcca
gatcttgttcatgagtacttgccatcagacaccaatactttattggccgttggtaacaag
gcattgcaagatcgtgaatgcattaacgtcttggtaacttcaaaacaacctcgtccacaa
tggttctcaattgaagaagcacaaaagctggttgatcacggtttaggctatgttgattgg
gcttcaactgataagagtgctaagccggatgtagtctttgcttcaactgaaactgaacca
acaatggaaactttggcagcaatcgatatcttgcacgacaagttcccagatcttaagatt
cgttacattaacgtggttgacgtgatgaagttaatgagccctaaggataataagaatgct
ctttctgatgaagaatttgatcgcttattccctaaggatgttccagtaatctttgcatgg
cacggctacaagaccatgatggaatcaatctggtttgctagaaaccgtcataacgttcac
attcactgctatgaggaaaatggtgacattactactccatttgacatgcgtgttttgaac
cacttggaccgtttcgatttagctaaggatgctgttgaaagcgttgaaaaattaaagggc
aagcatgcggacttcattagtcatatggatgacttgcttgaaaagcaccaccaatacatt
cgtgattatggtaaagatatgccagaagttactgaatggaaatggaaaggcttgaagtga

DBGET integrated database retrieval system