KEGG   Lactobacillus helveticus DPC 4571: lhv_0657Help
Entry
lhv_0657          CDS       T00625                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00040  Pentose and glucuronate interconversions
lhe00052  Galactose metabolism
lhe00500  Starch and sucrose metabolism
lhe00520  Amino sugar and nucleotide sugar metabolism
lhe01100  Metabolic pathways
lhe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lhv_0657
   00052 Galactose metabolism
    lhv_0657
   00500 Starch and sucrose metabolism
    lhv_0657
   00520 Amino sugar and nucleotide sugar metabolism
    lhv_0657
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lhv_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABX26811
UniProt: A8YU73
Position
637535..638434
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNK
RPIEDHFDSNPELEQDLEEKSKSKLLKLTQGITNLGVNLYYTRQPHPAGLGDAIYRARSF
VGDEPFVVMLGDDLMDDQVPLTKQLINRYDKTHASTIAVMPVPHEEVSKYGVIEPENEIM
PGLINVKSFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKDQLRAYIKKLSKQFEAEDKNNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagctgttattccagctgccggtttaggtactagattcttacctgca
acaaaggctttgcctaaagaaatgttgccaattgttgataaaccaacaattcaatttatt
gtagaagaagccaagaagtctggtattgaggatattttgatcgttattggtaagaataag
cgaccaattgaggatcattttgattctaatccagaacttgaacaagacttggaagaaaag
agcaaaagcaaattacttaaattgacccaaggaattaccaatttgggtgtcaatttgtac
tatactagacaaccacatccagctggtttaggggatgcaatttatcgtgctcgtagcttt
gttggtgatgaaccatttgtagtaatgcttggtgatgatttgatggatgatcaagtgcct
ttaaccaagcaattgattaatcgttacgacaagacacatgcctctactatcgctgtaatg
cctgtacctcatgaagaagtttctaaatatggggtaattgaacctgaaaatgaaatcatg
cctggtttgatcaacgttaagtcttttgtagaaaagcctgatgttgataaagctccaagt
gattacgctattattggccgttacttgcttacaccagaaatttttgatattttagctcat
caaaaaccaggtcgtggcggagaaattcaattaacagatgccattgatacgatgaataag
acacaacgcgtgtttgctcatgtatttaaaggtgaacgtcatgatgttggtaataaagag
ggctaccttgaaacctctattgaatatggactaaagcatcctgagattaaggatcaatta
cgtgcatatattaagaagttatctaagcaatttgaagcggaagataaaaataataaataa

DBGET integrated database retrieval system