KEGG   Lactobacillus helveticus DPC 4571: lhv_0745Help
Entry
lhv_0745          CDS       T00625                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lhv_0745 (tpiA)
   01230 Biosynthesis of amino acids
    lhv_0745 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0745 (tpiA)
   00051 Fructose and mannose metabolism
    lhv_0745 (tpiA)
   00562 Inositol phosphate metabolism
    lhv_0745 (tpiA)
Enzymes [BR:lhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lhv_0745 (tpiA)
Exosome [BR:lhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lhv_0745 (tpiA)
  Exosomal proteins of bladder cancer cells
   lhv_0745 (tpiA)
  Exosomal proteins of melanoma cells
   lhv_0745 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730675..731433
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTAEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGIDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVGQIKAALDGLTAEQVSNLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaagttacacatgaatccagaacaaact
gctgaattcgttgacgctgttaaggacaagttgccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttaagaaaagcagctaagggctcaaactta
cacatcggtgctgaaaactgttactttgaagacgaaggtgcttacaccggtgaaacttca
cctaaggtcttgaaagaaatgggtatagactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggctaaggcaatctttgctaat
ggcttaaagccaattatttgctgtggtgaatcacttgaaacccgtgaagcaaacaagcaa
gaagactgggttgttggtcaaattaaggctgctttagatggtcttactgctgaacaagtt
tcaaaccttgttattgcttatgaaccaatctgggctattggtactggtaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgttaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaatgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system