KEGG   Lactobacillus helveticus DPC 4571: lhv_0873Help
Entry
lhv_0873          CDS       T00625                                 

Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lhv_0873
Enzymes [BR:lhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     lhv_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858746..861097
Genome map
AA seq 783 aa AA seqDB search
MSEFTGKINGIVFENDKDLYKILDVEIIGSLENYSRSEIKVTGNFGDVQIGSSYHFDGKL
IMHEKFGLQFRANSYKPIMPHEEGSLTNYLSSNKFPGIGKKTAGTIIEELGLNALDILKE
NPAKIDTLSLTKKQKDSLLSGLNSMDSYSEIVLKLAQYGIRKQVAARLYQCYHGAALDKL
KEDPYAAINEVTGYGFKTADTLGKQLDIKNDDPRRINGAIYQILLDALSGEGDTYVSLSD
LLTAAKDLLQISEFDPIAICVNSLQKKGKIVVDGENAFLQNIYQTEVDIARSMKSLVESR
KLQEDEQYSDKKIEEAIKDAEQELKIEYDDTQKLAIKNALNNPISILTGGPGTGKTTIIN
GILLALRKLAEIPASSLYSEDPPFLLAAPTGRAAKRMGEITGISAKTIHRLLGLGIGDAN
AEDLNELNGEILIIDEMSMVDMFLFKQLLSSINQTRHIVFVGDKDQLPSVGAGNVFSDLI
KSHAFPTTVLKQIHRQGDESTIITLAHDVNEGKDQQALFKKTKNYSFISCRPELVGDAVG
QIVKLALKRGFDKDDVQVLSAMYHGSGGVNNLNDVIQEIMNPPKAKSKFLEVRNEVFRIG
DRILQLQNNPEKDIYNGQIGKIISIDEDNSKECMVANFDGREVSFGKKDLTDLTRAYAIT
IHKSQGSEFPLVILNLTMQNYVMLKRNLLYTAITRAEKNLVLVGDPRAFAAAFNTPGNDR
KTGLAEKICAQLGIKDVKADENTKEEVVESKPQKQEPEDYILTPEKIYSGEIDPMIGMEN
IKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattcaccggtaaaattaacgggattgtttttgaaaacgataaagatttatac
aaaatcctcgatgttgaaatcattggttcactcgaaaattattcacgtagcgaaattaag
gtaacaggaaattttggtgacgtgcaaattggaagtagctatcattttgatggcaaactg
attatgcatgaaaaatttggtttgcaatttcgtgctaatagttataaaccgatcatgcct
catgaagaaggttcacttactaattatttaagttctaataaatttccaggtattggtaaa
aaaacggcaggtaccattattgaagaattaggattaaatgctttagacattttaaaagaa
aatcctgccaaaatcgacaccttatctttaaccaaaaaacaaaaagatagtttattgtca
ggccttaattctatggattcttattccgaaattgttttaaaattggcacaatatgggatc
aggaaacaagtagccgctagactttatcaatgttatcatggtgcagctttagataaatta
aaagaggatccatatgctgctattaatgaagttacaggttatggctttaagactgcagat
accttgggcaaacaattagatattaaaaatgatgatccacgaagaataaatggtgccatt
tatcagattcttttggatgctttaagcggtgagggagatacatatgtctcactatccgat
ctgttaactgctgccaaagatttattacaaatttcagagtttgatccgattgctatttgt
gtaaattctttacagaaaaaaggaaaaatagtagttgatggtgaaaatgcctttttgcaa
aatatttatcaaacagaagtagatattgctcgatctatgaaaagcttggtagagagcaga
aaactgcaagaagatgagcagtatagcgacaaaaaaattgaagaagccattaaagatgcg
gaacaagagttaaagattgaatacgatgatacacagaaattagcaattaaaaatgctttg
aacaatcctatttcaattttgacgggtggtcctggtacaggaaaaactacgattattaat
ggaatattactggcattaaggaaattagcagaaatcccagcttcatcgctatatagtgaa
gatccaccatttttattagcggcgccaacaggtagagctgcaaagagaatgggtgagata
actggcattagtgctaaaaccatccaccgtcttttaggattggggattggagacgcaaat
gccgaggatttgaatgaactcaatggtgaaatcttaatcattgatgagatgtcgatggtt
gacatgttcctatttaagcagcttctctctagtatcaatcaaactcgacacattgtgttt
gtgggggataaggatcagttgccttctgttggtgccggaaatgtatttagcgatttaatt
aagtcacatgcttttcctactacggtattaaagcagattcaccgacaaggtgatgaatca
acgattattacattggctcatgatgtaaatgagggcaaagatcaacaagctttattcaaa
aagactaagaattattcatttattagctgtagacctgaattggtaggggatgcagtaggt
caaattgtaaaattggctttaaaacgtggcttcgataaagacgatgtacaagtattaagt
gcaatgtatcatggtagcggcggggtaaataatttgaatgatgttattcaagaaataatg
aatccacccaaagccaaaagtaaattcttagaagtgcgtaatgaagtctttcggattggc
gatcgaattttacaattacaaaataatcctgagaaagatatctataatggtcaaatcggt
aagataattagtatcgatgaagataattctaaggaatgcatggttgctaattttgacggt
cgggaagtaagttttggcaaaaaagatttaacagacttgaccagggcgtatgcgattact
attcataagtcacagggctcggaatttccgttagtaattttgaatttgactatgcaaaat
tatgtgatgcttaaacgaaacttgctttatacggcgattactcgtgctgagaaaaattta
gttttagtaggagatccgcgagcttttgcggcagcttttaatacaccaggaaatgatcga
aaaactggattggcagaaaaaatctgtgctcaattgggtattaaagatgttaaggctgat
gagaacacgaaagaagaggtagttgaatcaaagcctcaaaaacaagaaccagaagattat
atcttaacgcctgagaaaatttattcaggtgagatcgatccaatgattggaatggaaaat
attaaactataa

DBGET integrated database retrieval system