KEGG   Lactobacillus helveticus DPC 4571: lhv_0941Help
Entry
lhv_0941          CDS       T00625                                 

Definition
Beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_0941
Enzymes [BR:lhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lhv_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925106..926488)
Genome map
AA seq 460 aa AA seqDB search
MTEKRKLPSTFLWGNSVSSMQTEGAWNEDSKGLSVYDVRPATDNTSDWHVAIDEYHRYDE
DLDLLKNMNMNMYRIQISWSRVCPDGDGDFNQKGIDFYDRLVNAMLKRGIQPMICLYHFD
MPLNLAQKYNGFMSQHVVDAFVRFGKKMIDHFSDRAKYWIVFNEHNLYFQDEVFNISGCE
SGDKSLDDMYTIFHHTMMCHIRLANYIHENYSDVKIGGMLAYQQIYPATSKPEDVWAAKQ
VQEFLNFNIYDADTGRGYSLEVMQYAKNHGIEKDITDEDKEIMKKAKADFLAFSYYSSWV
LSSNKIPEGEAPSRYLNKGGVESKYVKTNDWGWAIDPLGFRNAITTMYNYYRIPIFPIEN
GIGLKETWDGEHMIEDDERIAYHRDHIKAMKDAIFDDGAEVLGYLGWGLIDIPSSHADME
KRYGAVYVNRSNHDLKDLKRVPKKSFYWFQKVLKDNGDEL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaagcgcaaattgccatccacattcctttggggcaactcagtttcaagtatg
caaactgaaggtgcatggaatgaagacagcaagggtctttcagtctatgatgtccgacct
gctactgacaatactagtgactggcatgtagcaattgatgaatatcatagatatgatgaa
gacctcgacttactgaagaacatgaacatgaacatgtaccgtattcaaatttcatggtct
cgtgtctgtccagacggtgacggcgacttcaatcaaaaaggtattgacttctatgatcga
ttagttaatgcaatgcttaaacgtggcattcaaccaatgatctgtctttaccactttgat
atgccactcaacttagcccaaaagtacaatggctttatgtcacagcatgtagttgacgcc
tttgtccgttttggtaaaaaaatgatcgatcattttagtgatcgagcgaaatattggatt
gttttcaatgaacataatctatatttccaagatgaagtttttaatatttcaggttgcgaa
tctggagataagagtttggacgatatgtacactatcttccatcatacgatgatgtgtcat
atccgattagcaaattacatccatgaaaattactcagatgtaaaaatcggtggaatgctt
gcttaccaacaaatttatccagcaacgagtaaacccgaagatgtttgggcagcaaagcaa
gtacaagagtttttaaactttaatatttacgatgctgacactggacgtggttattcacta
gaagtaatgcaatatgctaaaaatcatggcattgaaaaggacattacagatgaagataaa
gaaataatgaagaaagcgaaagctgacttcttagcattttcttactattcatcctgggtt
ttatccagcaataaaattcctgaaggtgaggctcctagccgttaccttaacaaaggcgga
gttgaatccaaatatgttaagacaaacgattggggctgggcaattgatccactaggattt
aggaatgcaattactacaatgtacaactactaccgcatccctattttccctattgaaaat
ggtattggcctcaaggaaacttgggacggcgagcatatgatcgaagatgatgagcgtatt
gcttatcaccgagatcatatcaaagctatgaaagacgctatttttgatgacggtgccgaa
gtacttggttatctcggctggggtttaattgatattccaagttcccatgctgatatggaa
aagcgctacggtgctgtatatgtcaacagatcaaatcatgatttaaaagatttaaaacgt
gtacctaagaaatcattctactggttccaaaaggtacttaaagataatggagatgaatta
taa

DBGET integrated database retrieval system