KEGG   Lactobacillus helveticus DPC 4571: lhv_0956Help
Entry
lhv_0956          CDS       T00625                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lhv_0956
   00670 One carbon pool by folate
    lhv_0956
Enzymes [BR:lhe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     lhv_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939818..940336
Genome map
AA seq 172 aa AA seqDB search
MIEFVWAEDQKHQIGLDGHLPWRLPADMAHFKEKTIGHPIIMGRKTFMSLPRLLPQRKHI
VLTHDQDLKKKYQDNDQVTIINSIAELGDYIQNHQGEKLCTVGGVSIFKALLDQVDVLEK
TEIDATFEADTVMPEIDYDQFKLVKKEHHEADEKNKYPYTFFTYQRKIKSIK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatttgtttgggcagaagatcaaaaacatcagataggtttagatggacatttg
ccgtggcgattgcctgcagatatggctcattttaaggagaaaacgattggtcatccaatt
atcatgggaagaaaaactttcatgagtttgccaaggttattgcctcagagaaagcatatc
gttttaacccatgatcaagatttgaaaaagaagtaccaagataatgatcaagtaacaatt
attaattcgatagcagaactaggtgattatattcaaaatcatcagggtgaaaagctttgt
acggttggtggggtgtcaatttttaaggcattgcttgatcaagtggatgttttagaaaaa
acggagatcgacgctacttttgaagcggatacggtgatgccggagatagattatgatcag
tttaaattggtgaagaaagaacatcatgaagctgatgaaaagaataaatatccgtacact
ttttttacttatcagagaaaaattaaatccattaaataa

DBGET integrated database retrieval system