KEGG   Lactobacillus helveticus DPC 4571: lhv_1202Help
Entry
lhv_1202          CDS       T00625                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/GTP cyclohydrolase I
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lhv_1202
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     lhv_1202
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     lhv_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184148..1185221
Genome map
AA seq 357 aa AA seqDB search
MMENVILSLGSNIGNREAYINKAVALLGNDPAILIDKASSFYETSPVGNVNQRAFINIAL
KIATTDSPEDLLTKIHQIELHLHRTRDVHWGPRTLDVDIIFWGDQKIKTESLIIPHPEAF
NRLFVLVPTLEIVTPEFPFYNQIKAQIQKLQKADQTIQLVQKQTQSKQVVESAIRQILNA
IGDDPDRPGLVETPDRVARMYNEIFSSEGLDDFEDYKLFNTKETDNSKMVMVKNIPFYSM
CEHHMMPFFGKAHIAYVPDHGKIIGLSKIPRLVDFVSHKLGLQEKLTDDIVAQMNRILAP
KGVAVIVDARHMCVEMRGVKKADSSTRTIRFSGVFDTDQTLRMTFLNSIGDVNGKTI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaatgtcattttaagtttaggtagtaatatcggtaatcgtgaagcctatatt
aacaaagccgttgcgctgttgggaaacgacccggctattttgattgataaagcttcaagt
ttttatgaaacttcaccggttggtaatgtgaaccagcgggcctttataaatattgcgctt
aaaatcgcaacaactgattcaccggaagacttgttaaccaaaatccaccaaatcgaattg
catttgcaccggacccgtgatgtacattggggaccgcggacattggatgttgatattatt
ttttggggtgatcaaaagattaagactgagtcgcttattattccgcatcccgaagcgttc
aaccgtttatttgtgctggtaccaacactggaaatcgtgacacctgaatttccattttat
aatcaaattaaggctcaaattcaaaaacttcaaaaagcagatcaaacaattcaacttgta
caaaagcagacgcaatctaaacaagtcgttgaaagcgcaattcgtcaaatcctgaatgcg
atcggagatgatccggatcgaccaggactggtggagacgccggatcgcgtcgcccggatg
tataatgaaattttttcgtctgaggggttggatgattttgaagactataaattgtttaat
accaaagagactgataattcaaaaatggtgatggtgaaaaacattccgttttattcaatg
tgtgagcaccacatgatgccgttttttgggaaagcccacattgcttacgtacctgatcac
gggaaaattattggcttaagtaaaatcccgagactggttgattttgtatcacacaagttg
ggccttcaagagaagctgactgatgatattgttgcccaaatgaaccgaattctggcaccc
aagggagtggcggtcattgttgacgcccgacacatgtgtgttgaaatgcggggcgttaaa
aaggctgattcatcaactcggacgattcgtttttctggtgtttttgacaccgaccagacg
ttaagaatgacatttttaaactcgataggtgatgttaatgggaaaacaatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system