KEGG   Lactobacillus helveticus DPC 4571: lhv_1204Help
Entry
lhv_1204          CDS       T00625                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00790  Folate biosynthesis
lhe01100  Metabolic pathways
Module
lhe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lhv_1204
Enzymes [BR:lhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lhv_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind NB-LRR
Motif
Other DBs
NCBI-ProteinID: ABX27236
UniProt: A8YVE9
Position
1186532..1187623
Genome map
AA seq 363 aa AA seqDB search
MEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTELAA
VIKSWPEVFGAENGTLQQIQAASRIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGGRNA
SVDGVLKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKHFPNIVLA
IDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLVAKYKPAVVTMFNGRNFNEQTETLSK
TMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPIMIA
ISRKSFAKRLFNLDSADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLKDQL
LLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaataaacaatcgtcaacaaacattcagcggcaacgtcaccatttct
tttaatgcgaatacagaagaattacccaaattaattaatctgttagctgaccagactgcc
aatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaattggcagct
gtaattaaaagttggccagaagtgtttggcgctgaaaacggtacgctgcagcaaatccag
gcagcttctcgaatccattttaagggtcggggatttgactttgatattacgaccaaacca
attatttattcgattttaaacttgacgccggattcattttacgatggtgggagaaacgct
tcagtcgatggggttctgaaacgaattgaagcagatctggcagccggaactgccatcttt
gaagtcggtggcaaatcttccaagccgcactttgatgatattagtgctgaagaggagtgg
gggcgaattaaaccgtttttggacgctattcacaagcattttccaaatattgttttggca
attgattccaatacaaacgcggttattgaagaagcactaaaaaatggtattcaaattatt
aacgacatcgatggctttaattctcaagcaaaactgaatttagttgctaaatacaaacct
gctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaaccttatcaaaa
acaatgatggatttctttacacatacaattagcgatttaacaggcgttgggcttgaaaaa
gaaaacattgtgattgacccgggcgttggcttttctgatcataatacgttagcttttgat
ctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgattatgattgca
atttcgcgaaaaagttttgctaaacggctgtttaatttggactcagcggatgatcgattg
attccaacgctgctatttgaagcatttatgacggttcttggcggtcgggttattcgggta
catgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaagatcagcta
ttgctaaagtaa

DBGET integrated database retrieval system