KEGG   Lactobacillus helveticus DPC 4571: lhv_1446Help
Entry
lhv_1446          CDS       T00625                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lhe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lhe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1431496..1432452)
Genome map
AA seq 318 aa AA seqDB search
MKNLNLVALPHFVSVENLKNDEVKALIKRAEYFKKSGAVARLTSPVYVTNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLVMNALGIDLEVIRHSQNEYYEDLIN
LKQHQKLNIGVINAGDGSGQHPSQCMLDMMTIHEHFGHFKGLKVAIVGDITNSRVAKSDM
ELLTRLGAEVYFSGPEYWYSKDFDQYGKYEELDKLIPEMDVMMLLRVQHERHSGDPNEKK
FDAHRYHEKYGINHKRYEAMKKDTIIMHPGPINHDVELSGDLVESDKCMFVRQMENGVFM
RMAMLEAVLRGRKLGGLE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaatcttgtcgctttaccacattttgttagtgttgaaaatttgaaaaat
gatgaagtaaaggctctgattaagcgtgcggaatattttaaaaaaagtggagctgtagct
aggttaactagtccggtctatgtcactaacatgttttttgaagattccagtagaactcac
acaagttttgaaatggcagaaagaaaactaggtttaactgtcatcccatttgatccagct
cattcatctgtcaacaagggtgagaccttatacgacacttcactagtgatgaatgcactt
ggcatcgaccttgaagtaattcgccactcacaaaatgaatattacgaggatttgattaat
ttaaagcagcatcaaaaattaaacatcggtgtgattaatgcaggagatggctcaggtcag
catcccagtcaatgcatgcttgatatgatgactattcatgaacactttggccattttaaa
ggtttgaaagtggcaatcgtaggtgacatcactaattctcgcgtagctaaaagtgacatg
gaacttttaactagacttggcgcagaagtttacttctctggccctgaatattggtactct
aaagattttgaccaatatggcaagtatgaggaacttgataaattgattcctgaaatggat
gtcatgatgttgctacgggtgcaacacgaacgtcatagcggtgatcctaatgaaaagaag
tttgatgcacatcgttatcatgaaaaatacggtattaatcacaaacgatatgaagcaatg
aaaaaagatacaattattatgcacccgggtccaattaatcacgatgtcgaattaagtggt
gacctggtagaaagtgacaagtgcatgtttgttcgccaaatggaaaacggcgtctttatg
agaatggccatgttggaagcagttttgcgtggcagaaaactcggagggcttgaataa

DBGET integrated database retrieval system