KEGG   Lactobacillus helveticus DPC 4571: lhv_1499Help
Entry
lhv_1499          CDS       T00625                                 

Definition
galactose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_1499
   00052 Galactose metabolism
    lhv_1499
Enzymes [BR:lhe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     lhv_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1476019..1477014)
Genome map
AA seq 331 aa AA seqDB search
MKTSFNKYGRKDGKDLCEIVLENDHGMIVKVLNYGATLEKVLLNDENMILSLNSPADYSQ
ERNYLGGTVGRIAGRVRKGQWRHGLETHQLPINDGENHIHGGIGTDTEVWDFKPSCSENS
ARVDLTLLDPDGHNDYPGNLKIHVKYELDNDNTLHYSINAVSDQLTIFNPVNHVYFTLGE
KDNIKDLLLQMNADYYLPVDHSGMPDRGMEKVAGTAFDFRKTKRVGDALEADDPQIKDRD
GMDHPFILNGNQPGAVLSSEDHKVTVNTDAPSLIIYTGNGFDHTGKYTADFGQYAGITFE
AQIPPAEDSDLGRITLLPNEEFERNVSWKFE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagttttaataaatatggcagaaaagatggtaaggacctttgcgagatcgtt
ttggaaaatgatcatggcatgattgttaaggtgcttaattatggtgcaacgctagaaaaa
gttttgcttaatgacgagaatatgattttgtcattgaattcaccagctgattattctcaa
gaaagaaattatttaggtggtacagttggccgtattgctggtagagttagaaaaggtcaa
tggagacatggacttgaaactcatcaattaccaatcaatgacggtgagaatcatattcac
ggcggaattggtacagatactgaagtctgggattttaagccttcttgtagtgaaaatagt
gcacgagtagatttaactttattggatccagatggtcataatgattatccaggcaattta
aagattcatgtcaaatatgaattggataatgataatactttgcattactcaatcaatgcg
gtgagtgaccaattaactatttttaatccggtaaatcatgtttactttaccttgggtgaa
aaagataatattaaggatttgttgttgcaaatgaatgccgattattatttaccggttgat
cattctggaatgcctgatcgcgggatggagaaagttgctggcactgcttttgactttaga
aagactaaacgtgttggggatgctttagaagctgacgatcctcaaatcaaagatagagac
gggatggatcatccatttattttgaatggtaatcaacctggtgcagttttaagttctgaa
gatcataaggtgactgtaaatactgatgccccatcattgattatttatactggaaatgga
tttgatcatactggaaagtacactgctgactttggtcaatatgctggcattacttttgaa
gcacaaattccaccagctgaagatagcgatttaggtcgcattacattattgccgaatgaa
gaatttgagcgaaatgtaagctggaagtttgaataa

DBGET integrated database retrieval system