KEGG   Lactobacillus helveticus DPC 4571: lhv_1542Help
Entry
lhv_1542          CDS       T00625                                 

Definition
LacA
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lhe00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521651..1522724)
Genome map
AA seq 357 aa AA seqDB search
MLEPEEGKYDFSELDKVVKKLSDANFDIVIGTSTAAMPAWMFKKYPDVARVDYQGRRHVF
GQRYNFCPNSKNYQRLAGNLVEELAKHYQNNPNIVVWHVNNEYGGNCYCENCQHEFRKWL
KDKYQTLDALNKAWNMNVWSHTIYDWDEIVVPNELGDAWGPEGSETIVAGLSIDYLRFQS
ESLQNLFKMEKQIIKKHDSETPVTTNFHSLPNKMVDYQKWAKDQDIISYDSYPTYDAPTY
KPAFLYDLMRSLKHQPFMLMESAPSQVNWQPYSPLKRPGQMAATELQAVVAHGVDTVQFF
QLKQAVGGSEKFHSAVIAHSQRTDTRVFKELVDLGHKLKRAGSTILGSTINELRPKN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacctgaagaaggtaagtatgatttttccgagctagataaagtagttaaaaaa
ttatcagatgcgaactttgatatcgtaattggtacgtctactgctgcaatgccggcttgg
atgtttaaaaagtatccagatgttgccagagttgattatcaaggcagacgacatgttttt
ggtcagcgatacaacttttgcccgaatagcaaaaattatcaaagattagctggtaattta
gttgaagaattagctaagcattatcaaaataatcctaatattgttgtttggcacgtaaat
aatgagtatggtggcaattgctactgtgagaattgtcaacatgaatttcgtaaatggctg
aaggataagtatcagactctagatgctttaaacaaagcatggaatatgaatgtttggagc
catactatctatgactgggatgaaattgtagttccaaatgagttaggggatgcatggggc
cccgaaggcagtgaaactattgttgcgggtctttcaattgattatttgcgttttcaatca
gaaagtttgcaaaatctgtttaagatggaaaagcaaattattaaaaaacatgattctgag
actcctgtgactaccaatttccatagcttaccaaataagatggttgactatcaaaagtgg
gctaaagatcaagatattatttcttatgattcttatcctacttacgatgcacctacatat
aaaccagcatttttatatgacttgatgcgtagcttgaaacatcagccattcatgttaatg
gagtcagctccgtcacaggttaactggcagccgtatagtcctttgaagagacctggacaa
atggcggcaaccgaattgcaagccgtggtggctcatggtgtagataccgttcaattcttt
caattaaaacaagctgtcggtggctcagaaaaatttcatagtgcagtaattgcacattca
caaagaacagataccagagtatttaaagaattagtagatttaggtcataaattaaaaaga
gccggttcaacgattttaggctcaacaattaatgaactgagacctaaaaattag

DBGET integrated database retrieval system