KEGG   Lactobacillus helveticus DPC 4571: lhv_1549Help
Entry
lhv_1549          CDS       T00625                                 

Definition
LacL
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    lhv_1549
  Lipid metabolism
   00600 Sphingolipid metabolism
    lhv_1549
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    lhv_1549
Enzymes [BR:lhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     lhv_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1529312..1531198
Genome map
AA seq 628 aa AA seqDB search
MQANINWLDNPEVFRVNQLPAHSDHPFFRDYREWQKQHSSYQQSLNGKWKFHFSANPMDR
PQDFYQRDFDSSNFDSIPVPSEIELSNYTQNQYINVLFPWEGKIFRRPAYALDPNDHEEG
SFSKGADNTVGSYLKRFDLSSALIGKDVHIKFEGVEQAMYVWLNGHFVGYAEDSFTPSEF
DLTPYIQEKDNLLAVEVFKHSTASWLEDQDMFRFSGIFRSVELLGIPATHLMDMDLKPRV
ADNYQDGIFNLKLHFIGKKAGSFHLLVKDIKGHTLLEKNEDIKENVQINNEKFENVHLWN
NHDPYLYQLLIEVYDEQQNLLELIPFQFGFRRIEISPEKVVLLNGKRLIINGVNRHEWDA
KRGRSITMSDMTTDINTFKENNINAVRTCHYPNQIPWYYLCDQNGIYVMAENNLESHGTW
QKMGEIEPSDNVPGSIPQWKEAVIDRARNNYETFKNHTSILFWSLGNESYAGDNIIAMNE
FYKSHDDTRLVHYEGVVHRPELKDKISDVESCMYLPPKKVEEYLQNDPPKPFMECEYMHD
MGNSNGGMDSYIKLLDKYPQYFGGFIWDFIDQALLVHDEISGHDVLRYGGDFDDRHSDYE
FSGDGLMFADRKPKPAMQEVRYYYGLHK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaatatcaattggctagataatcctgaggtattcagggtcaatcaattgccc
gcacacagtgatcatcccttttttagagattatcgcgagtggcaaaagcaacacagtagc
tatcaacaaagtttaaatggaaaatggaaatttcatttttccgctaatcctatggatcgt
ccacaagatttttatcagcgtgattttgattcttcaaattttgattcgatcccagttcca
agtgaaatcgaattgagcaactatactcaaaatcaatatattaatgtcctctttccttgg
gaaggcaaaatcttccgccgcccagcttacgctttagatcctaatgatcatgaagaaggc
tcatttagcaaaggcgcagataacacagtcggttcatacttgaagcgatttgatttaagc
tccgccttaattggaaaagatgttcatattaaatttgaaggcgtcgaacaagcaatgtat
gtatggttaaacgggcattttgtgggctatgcggaagacagctttactccttcagaattt
gatttaacgccatatattcaagaaaaagataatcttttagcagtagaagtttttaaacac
agtactgcatcttggctagaagaccaagacatgttccgcttctctggcatcttccgctca
gttgaactactaggtatccccgctacccacttaatggacatggatttgaaaccacgagtt
gcagataattatcaagatggcatcttcaaccttaagcttcattttattggtaaaaaagcc
ggttcattccatttattagtcaaagatattaaggggcatactcttctggagaaaaatgaa
gatatcaaagagaacgttcaaattaataatgaaaaattcgaaaacgtgcatctttggaat
aaccatgatccatatctttatcagcttctaattgaagtttatgatgaacaacaaaacttg
ctagagctgattcctttccaatttggctttaggagaattgaaattagtccagaaaaagtt
gttttgttaaatggcaagcgtttaattatcaatggagttaaccgacatgaatgggatgca
aaacgtggtcgcagcataacaatgagtgatatgacaactgacattaatacttttaaagaa
aataatattaatgctgttagaacatgtcactacccaaaccaaattccgtggtattatctt
tgcgatcaaaatggcatttatgtcatggccgagaataaccttgaatcacatggtacttgg
caaaaaatgggagagattgaaccttctgacaatgtaccaggttcgattccgcaatggaaa
gaagcagtgattgatcgagcacgcaataactacgagactttcaagaatcacacctctatt
ctcttttggtcacttggcaacgaatcctatgctggagacaacatcatcgcaatgaatgaa
ttttacaaatctcacgatgatacacgcttagttcactatgaaggcgtagtgcaccgtccc
gaattaaaagataaaatttcagatgttgaaagctgtatgtatttaccacctaaaaaggtt
gaagaatacttgcaaaatgatccaccaaagccatttatggaatgcgaatatatgcatgac
atgggcaattctaacggcggcatggattcatatatcaaattacttgataaataccctcaa
tacttcggtggatttatctgggactttatcgatcaggcattattggttcatgatgaaatt
agtggacatgatgttttgcgttatggcggcgattttgatgatcgtcattccgattatgaa
ttttctggcgatggtttaatgttcgcagatagaaaaccaaaaccagctatgcaggaagtg
agatactattatggattacacaaataa

DBGET integrated database retrieval system