KEGG   Lactobacillus helveticus DPC 4571: lhv_1784Help
Entry
lhv_1784          CDS       T00625                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lhv_1784
   00052 Galactose metabolism
    lhv_1784
   00500 Starch and sucrose metabolism
    lhv_1784
   00520 Amino sugar and nucleotide sugar metabolism
    lhv_1784
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lhv_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750972..1751847)
Genome map
AA seq 291 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAKASGIEDILIVTGKNK
RAIENHFDSNPELEQDLEKTGKSGLLKLTQEITDLGVNVYYTRQPYPAGLGDAVYRARSF
VAGEPFVIMLGDDLMKDKVPLTKQLINDYDKTHASTIAVMKVPHKEVSKFGVIAPDGNIA
PDLYNVKNFVEKPAVDKAPSDLAIIGRYLLTPEIFDILEHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERFDVGNKEGYLETSIQYGLIHPETRDALRKYIKELGKKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcgattatcccagcagcaggattaggtactagatttttgccagca
actaaggcaatgcctaaggaaatgttgccaattgttgacaagccaacgattcaatttatc
gtggaagaagctaaggcttcaggaatcgaagatattttaatcgttaccggtaaaaacaag
cgtgcgattgaaaatcacttcgactctaaccctgaattggagcaagacttggaaaagacc
ggtaaatctggtttgctaaagttaacccaagaaattactgatttaggtgtgaacgtgtac
tatactcgtcaaccatacccagctggcttgggggatgccgtctaccgcgcacgtagcttc
gtagctggtgaaccattcgtgattatgcttggcgacgacttgatgaaggacaaggtgcct
ttgactaagcaattgatcaacgattacgacaagactcatgcatcaaccattgccgttatg
aaggtgccacacaaggaagtttccaagttcggggtaattgcaccagatggcaatatcgca
cctgatttatataatgttaaaaactttgtggaaaagccagctgtagacaaggctccaagt
gatttggcaattatcggtcgttacttgttgacacctgaaattttcgacattttggaacat
caaaaaccaggtcgtggtggcgaaattcaattgactgatgcaattgataccatgaacaag
acacaacgcgtatttgcccatgtatttaagggagaacgctttgacgtgggtaacaaggaa
ggctaccttgagacttctatccaatacggtttaatccaccccgaaactcgcgatgctctt
cgcaagtacatcaaggaattaggtaagaagttataa

DBGET integrated database retrieval system