KEGG   Lactobacillus helveticus DPC 4571: lhv_1817Help
Entry
lhv_1817          CDS       T00625                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00230  Purine metabolism
lhe01100  Metabolic pathways
Module
lhe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lhv_1817
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lhv_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ABC_tran AAA_17 AAA_22 Rad17 RsgA_GTPase AAA_23 AAA_24 dNK Zeta_toxin AAA_14 PRK AAA_28 AAA_16 ATPase AAA_29 PduV-EutP AAA_5 TsaE AAA Cytidylate_kin APS_kinase T2SSE CPT
Motif
Other DBs
NCBI-ProteinID: ABX27674
UniProt: A8YX96
Position
complement(1787350..1787895)
Genome map
AA seq 181 aa AA seqDB search
MKKIILIAGPSGAGKTTISDYLNEKYGIPRVLTHTTRPMRSGEKQNFSYHFETDESFKTL
HFFEHIRYGSYQYGSSREALNLAWKKSDLVSLIVDIKGVYTYLKQLGNKVYFLYVTTSTK
EELKERLLKRGDDPEKIKERLSGSELNLLSEDLKEYAHILVNDNLSETKSKLDSIVSRLE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaataattttaatcgcgggcccgagcggtgccggaaagacaacgatttctgat
tatttaaatgaaaaatatggaataccacgtgtcttgacacatacgacgcgtccaatgaga
tcaggggaaaagcagaatttctcctatcattttgaaacggatgaaagcttcaagacactg
cacttttttgaacatattagatatgggtcttatcaatatggttcaagtcgtgaagcctta
aacctcgcttggaaaaagagtgatctcgtttctttaattgtcgatattaagggtgtttac
acttatctaaaacaattaggtaataaagtttatttcctttatgtgacaacttcgacgaag
gaagagctaaaagagcgccttttaaagcggggagacgatcccgaaaaaatcaaagagcga
ctcagcggcagtgaattaaacttattgtcggaagacttgaaagaatacgctcacatatta
gttaatgataatctatcagaaactaagagtaagctggattcaatcgtatcaaggcttgaa
gagtga

DBGET integrated database retrieval system