KEGG   Lactobacillus helveticus DPC 4571: lhv_1817Help
Entry
lhv_1817          CDS       T00625                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lhv_1817
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lhv_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1787350..1787895)
Genome map
AA seq 181 aa AA seqDB search
MKKIILIAGPSGAGKTTISDYLNEKYGIPRVLTHTTRPMRSGEKQNFSYHFETDESFKTL
HFFEHIRYGSYQYGSSREALNLAWKKSDLVSLIVDIKGVYTYLKQLGNKVYFLYVTTSTK
EELKERLLKRGDDPEKIKERLSGSELNLLSEDLKEYAHILVNDNLSETKSKLDSIVSRLE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaataattttaatcgcgggcccgagcggtgccggaaagacaacgatttctgat
tatttaaatgaaaaatatggaataccacgtgtcttgacacatacgacgcgtccaatgaga
tcaggggaaaagcagaatttctcctatcattttgaaacggatgaaagcttcaagacactg
cacttttttgaacatattagatatgggtcttatcaatatggttcaagtcgtgaagcctta
aacctcgcttggaaaaagagtgatctcgtttctttaattgtcgatattaagggtgtttac
acttatctaaaacaattaggtaataaagtttatttcctttatgtgacaacttcgacgaag
gaagagctaaaagagcgccttttaaagcggggagacgatcccgaaaaaatcaaagagcga
ctcagcggcagtgaattaaacttattgtcggaagacttgaaagaatacgctcacatatta
gttaatgataatctatcagaaactaagagtaagctggattcaatcgtatcaaggcttgaa
gagtga

DBGET integrated database retrieval system