KEGG   Lactobacillus helveticus H9: LBH_0964Help
Entry
LBH_0964          CDS       T03040                                 

Definition
Phosphoenolpyruvate carboxykinase (GTP)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lhh  Lactobacillus helveticus H9
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lhh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBH_0964
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBH_0964
  Energy metabolism
   00680 Methane metabolism
    LBH_0964
Enzymes [BR:lhh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LBH_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1009303..1012041
Genome map
AA seq 912 aa AA seqDB search
MTVKKLENSSDVNVVTEEVKILTNLLNESTEQLIGKELFTKIQNLIKISADKNYQELEDQ
IASLDNREMIVVARYFATLPLLINISEDVELASKVYVLNNTNQDYLGKLNDTIDIVAQKK
NAKEILEKVNVVPVLTAHPTQVQRKTVLELTDKIHKLLRNYREVKNGIINREEWTEELRA
CIEILMQTDIIRGHKLKVSNEITNVLTYYPKSLISAITKFTARYKELAKKHGLDIPDATP
ITMGMWIGGDRDGNPYVTADTLKLSATLQSQVIFEYYIKQINQLYRSISLSTSYMKPSTE
VMHLSELSNDDSPFRTNEPYRRAFYYIESRLVRSEQKLLNITNQHSFLKERDVEHLDQIP
AYENAQEFKADLEIIKRSLEENRDQAVVKSYFTEILEAIDVFGFHLATIDMRQDSSVNEA
CVAELLKSAEICDHYSDLSEKEKVSLLLNELNNDPRNLHANNKPKSELLQKELKIYKTAR
DLKDRLGEDVIKQHIISHTESVSDMLEQAIMLKEYDLLDNQSARVQVVPLFETVEDLNNA
RDIIKEYLNLDIVKKWLVSQHNYQEVMLGYSDSNKDGGYLASCWNLYKAQKDLTAIGEEL
GIKITYMHGRGGTVGRGGGPSYEAITAQPFKTINDRIRMTEQGEIIQNKYGNKDAAYYNL
EMLVSATVDRIASKQIVSEEYIADFRSSMDEIVTESNEIYKKLVFENPNFLDYFLQATPI
KEISNLNIGSRPASRKKLSDFSSLRAIPWVFSWSQSRVMFPGWYGVGSAFKHFIDADKNN
LQELRHMYQGWPFFHALLSNVDMVLSKSNMEIAKQYAELCQDEKTKSVFDIIYQEWKLTK
QIILQIEGHDDLLSDAPNLKNSLAARMPYFNILNYIQLEMIKRDRKDEIQGVFQSIIPIT
INGVASGLRNSG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaaaaaattagaaaatagcagcgatgtaaatgtagtgactgaagaagttaaa
attttaactaacttgcttaacgaatctacagaacaattaattggtaaagaactttttact
aagattcaaaatctgattaaaatttctgcagataaaaattatcaagaactcgaagatcaa
attgcaagcttagataatcgtgaaatgatcgtagttgctcgttattttgctacattgcca
cttttgattaacatctcagaagatgtggaattggccagcaaagtctatgtattgaataat
accaaccaagactacttaggcaaattaaacgataccatcgatattgttgctcaaaagaag
aatgctaaggaaatcttggaaaaggtgaatgtagttcctgttttaactgcacacccaacc
caggttcaaagaaagactgtacttgaattaacagataagatccacaagcttttgcgtaat
tatcgtgaagttaaaaacggcattattaaccgtgaagaatggacagaagagttacgtgct
tgcattgaaattttaatgcagacagatattattcgaggtcataaattaaaggtttctaac
gaaatcaccaatgtcttgacttactatcctaagtctttaatttcggcaattaccaagttc
actgctcgttataaggaattagctaaaaagcatggcttagatattccggatgctacacct
attacgatggggatgtggatcggtggagaccgtgacggtaatccatacgttactgcagat
actttgaaattaagtgcaacacttcaaagccaagttatctttgaatattacattaaacaa
atcaatcaactttatcgttcgatttctttatccacttcttatatgaaaccttcaacagaa
gtgatgcatttatccgaattatcaaatgacgattcaccattcagaactaatgaaccatat
agacgcgctttctattacattgagagtcgtttagttcgcagtgaacaaaaattactaaat
atcactaaccaacatagtttccttaaagaacgtgatgttgaacatttagatcagattcct
gcttatgaaaatgcgcaagaatttaaggcggacctagagattattaagcggtcattagaa
gaaaatcgcgatcaagcagtagttaagagttactttaccgaaattttagaagcaattgat
gtttttggcttccatttagctacaattgatatgcgacaagattctagcgttaatgaagca
tgtgtagccgaattgcttaagagtgcagaaatttgtgatcattacagcgatttaagcgaa
aaagaaaaggtaagtcttttacttaatgaattaaacaatgatccacgtaacttgcatgca
aataacaaacctaagtcagaattattgcaaaaagaattaaagatttacaaaactgctcgt
gatcttaaggatcgcttaggcgaagatgtaattaagcaacacattatatctcatactgag
agtgtttcagacatgctagaacaagcaatcatgctcaaagaatatgatttgcttgataat
caaagtgctcgagttcaagttgtgcctttatttgaaacagtcgaagacttgaataatgca
cgtgacattattaaggaatatttgaacctcgatatcgttaagaagtggctcgtttctcaa
cataactatcaagaagttatgttaggctattcagattctaataaggatggtggctactta
gcctcatgctggaatctttataaagcacaaaaagacttaactgctattggtgaagaatta
ggtatcaagattacttatatgcatggtcgtggcggtaccgttggccgtggtggtggtcca
tcttatgaagcaattactgcacaaccatttaagacaatcaatgaccgcattagaatgact
gaacaaggggaaattattcaaaacaagtatggcaacaaggatgctgcttactataatttg
gaaatgcttgtttcagctactgttgatcgaattgcatcaaaacaaattgttagtgaagaa
tatattgcagatttccgttcatcaatggatgaaatcgttacagaaagtaatgaaatttat
aagaaattagtctttgaaaatccaaacttcttagattacttcttacaagcaaccccaatt
aaagaaatttctaacttgaatatcggttcacgtccagcttcaagaaagaagctttccgac
ttctctagtttgagagctattccttgggtattctcttggtcacaaagtcgggtaatgttc
ccaggctggtacggcgtagggtcagcctttaagcactttattgatgcggacaagaacaat
ttgcaggaattacgccacatgtaccaaggttggccattcttccatgctttgctttccaat
gtagacatggttttatcaaaatctaatatggaaattgccaagcaatatgctgaactatgt
caggatgaaaagactaagtcagtctttgacattatttatcaagaatggaaattaactaaa
cagattattcttcaaattgaaggtcacgatgatttgcttagtgatgcaccaaacttgaag
aacagtttagcagctagaatgccatactttaatattttgaactatattcaattagaaatg
attaaacgtgatcgtaaagacgaaatccaaggcgtcttccaaagcatcattccaattact
attaacggtgtggcttctggtcttcgcaattcgggataa

DBGET integrated database retrieval system