KEGG   Laribacter hongkongensis: LHK_00011Help
Entry
LHK_00011         CDS       T00884                                 

Gene name
pcm2
Definition
Pcm2 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lhk  Laribacter hongkongensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10882..11535
Genome map
AA seq 217 aa AA seqDB search
MDFENARFNMIEQQIRPWDVLDPRVLDCLFAAKREEFVPADSRLLAFADLELPLPTGGHM
LAPRVEARLLQALDVQSDDAALEIGTGSGYLTALLANMARHVYSVDLSAQASEIAAASLA
RNGVRNVTLSVGNGIDGDSKHAPFNVIVLGGSVPEMPEQLKTQLAPGGRLVAVVGEAPAM
QAVLVTRGEGDNFREEVLFETVVEPLAQVKVPSRFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgaaaacgcccgtttcaacatgatcgaacagcagatccgcccctgggatgtc
ctggacccccgtgtgctggactgcctgtttgcagccaagcgcgaagagttcgttcccgct
gacagccgcctgctggcctttgccgacctggagctgccgctgcccaccggcggacacatg
ctggctccgcgggtagaagcccggctgttgcaggcgctggatgtccagtcggacgatgcc
gcccttgagatcggtaccggcagcggctatctgaccgccctgctggccaacatggcccgt
catgtgtattcggtcgacctgtcggcacaggccagcgaaatcgccgccgccagcctggcc
cgtaacggtgtccggaatgtcacgttgtcggtcggcaacggcatcgatggcgacagcaag
cacgcacctttcaacgtcatcgtactgggcggatcggtgccggaaatgccggaacagctg
aaaacccagctggcccccggtggacggctggtcgctgtcgtcggcgaagcaccggccatg
caagcagtcctggtcacccggggcgaaggcgacaacttccgcgaagaagtgttgtttgaa
accgtggtggaaccgctggcacaggtcaaggtacccagccgtttcgtgttttga

DBGET integrated database retrieval system