KEGG   Laribacter hongkongensis: LHK_00071Help
Entry
LHK_00071         CDS       T00884                                 

Gene name
hemD
Definition
(GenBank) HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00860  Porphyrin and chlorophyll metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
Module
lhk_M00121  Heme biosynthesis, glutamate => heme
lhk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LHK_00071 (hemD)
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LHK_00071 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACO73067
UniProt: C1D9V4
Position
complement(68361..69107)
Genome map
AA seq 248 aa AA seqDB search
MSAPLVIITRPHEAGAPLAAALRTAGFAPFEWPLLALEPEPEALDRLPAALAGADWLVVV
SPSAARLIAPALARLPAGLRLAAVGRATAQVLEQASGRPVLYPATGNDSEALLALPDWGA
LDGRTVVIAKGHGGRPWLAENLARRGARVVPLALYRRRKLTPDPAALQAALAVHPQAAVL
VTSTEIAEAWRQAAGDALWPSLQSIMHIAPHPRIAERLTALGVMRVKTTGAGDDAVIDAL
TDWFLRHD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccctggtcatcatcacccggccgcacgaggccggtgccccgctggccgct
gccctgcggacggccggcttcgccccgttcgagtggccactgctggcgctggagccggaa
ccggaggcgctggaccggctgccggctgccctggccggcgccgactggctggtggtggtc
agcccgtcagcagcccggctgattgcgccggcgctggcccggctgccggctggcctgcgg
ctggcagcggtcggacgggccacggcacaggtgctggaacaggccagcggccggccggtg
ctgtatccggccaccggcaacgacagcgaagccctgctggccctgccggactggggcgcg
ctggacgggcgcacggtagtgatcgccaagggccacggcggccgtccctggctggctgaa
aaccttgcccggcgcggcgcccgggtggtaccgctggcactctaccgccgccggaaactg
acaccggacccggccgccctgcaggcggcactggccgtccatccgcaggccgccgtgctg
gtcaccagcactgaaattgccgaagcatggcggcaagcggctggcgacgccctgtggccg
tcgttacaatcaatcatgcatatcgcaccgcacccgcggattgccgaacgcctgaccgcg
ctgggcgtcatgcgggtgaagacaaccggcgccggtgacgatgctgttatcgacgcgctg
accgactggtttctcaggcatgactga

DBGET integrated database retrieval system