KEGG   Laribacter hongkongensis: LHK_00132Help
Entry
LHK_00132         CDS       T00884                                 

Gene name
aceF
Definition
(GenBank) AceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00020  Citrate cycle (TCA cycle)
lhk00620  Pyruvate metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
Module
lhk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_00132 (aceF)
   00020 Citrate cycle (TCA cycle)
    LHK_00132 (aceF)
   00620 Pyruvate metabolism
    LHK_00132 (aceF)
Enzymes [BR:lhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LHK_00132 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 GCV_H PYNP_C CAT PASTA
Motif
Other DBs
NCBI-ProteinID: ACO73128
UniProt: C1DA15
Position
complement(135987..137630)
Genome map
AA seq 547 aa AA seqDB search
MSHPIEIKVPDIGGHAGVDVIDVLVRPGDTLAVDAPLVTLETDKATMDVPSTHAGRVIDV
KVKTGDKVSEGSLLVVLDTSATATAAAPAADAPPATAAAPAAKAPAAPAATGQRLTLRVP
DIGGHANVDVIDVPVKPGDLLAVDATLATLETDKATLDVPAEQAGRVIEVRVKAGDKVSE
GRELVVIETTETATAQPAAPAVVAASASAPAPATPAPAAAVASQPAAVAPAAAVTAIDEA
GFTRAHAGPSVRRLARELGVDLARVTGSGRKGRILDADLKAWVKATLAVPATAAPATGPS
LGGGLDLLPWPKVDFAKFGPVETRPLSRIKKLSGANLARNWAMIPHVTQFDEADITDMEA
FRKDMGNELKADGIKLTPLAFLIKAVVAALKKYPEFNASLDGDQLVLKQYYHVGFAADTP
NGLVVPVVRDADQKSLIELAQDTALLAKKAREGKLLPTEMQGGCFSISSLGGIGGTAFTP
IINAPEVAILGVSKSEIKPKWDGQAFAPRLMLPLSLSYDHRVIDGAAAARFTAYLGQLLA
DIRRLML
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcccatcgaaatcaaggtgcccgatatcggcggccacgccggtgtcgatgtc
atcgacgtgctggtcaggcccggtgacaccctcgccgtcgacgccccgctggtcacgctg
gaaaccgacaaggccaccatggacgtgccgtccacgcacgccggccgcgtcattgacgtc
aaggtcaagaccggcgacaaggtcagcgaaggttcgctgctggtcgtgctggatacctct
gccactgcaactgctgcggcaccggctgccgacgctcctccggccacagctgctgctccg
gctgcaaaggcaccggccgcaccggccgccactggccagcgcctgaccctgcgcgtaccc
gacatcggcggccacgccaatgtcgacgtgatcgacgtaccggtaaaacccggcgacctg
ctggccgtcgatgccaccctcgccacgctggaaaccgacaaggccacgctggacgtaccg
gccgaacaggccggccgcgtgatcgaagtccgagtcaaggccggcgacaaggtcagcgaa
ggcagagagctggtggtgatcgaaaccacagaaaccgccaccgcacagccggctgctccg
gcagtcgttgccgcctcggcctccgccccggcccccgccacgccggcgcctgcagctgcc
gtagccagccagcctgccgccgttgcgcccgccgccgccgtcacggccatcgacgaagcc
ggtttcaccagggcccacgccggcccgtcggtacgccggctggcccgcgagctgggagtc
gacctggcccgcgtcaccggttccggccgcaagggacgcattctcgacgccgacctcaag
gcctgggtcaaggccacgctggccgtaccggccacggccgcccccgctaccggcccgtcg
ctgggcggcggactcgacctgctgccgtggccgaaggtggacttcgccaaattcggtccg
gtcgaaacgcggccgctctcccgcatcaagaagctgtccggcgccaatctggcgcgcaac
tgggcgatgatcccgcacgtcacccagttcgacgaagccgacatcaccgacatggaagcc
ttccgcaaggacatgggcaacgagctgaaggccgacggtatcaagctcacgccgctggcc
ttcctgatcaaggccgtggtggctgctctgaagaaatacccggaattcaacgccagcctc
gatggcgaccagctggtgctcaagcagtactaccacgtcggttttgccgccgacacgccc
aacgggctggtggtgccggtggtgcgcgatgccgaccagaagagcctgatcgagctggcg
caggacactgccctgctggccaagaaggcccgcgagggcaagctgctgccgaccgagatg
cagggcggctgcttcagcatctccagcctcggcggcatcggcggcaccgcgttcacgccg
atcatcaatgccccggaagtggcgatccttggcgtgtccaagtccgagatcaagcccaag
tgggacggccaggccttcgcgccgcgcctgatgctgccgctgagcctctcctacgaccac
cgcgtgatcgacggcgctgccgccgcacgtttcaccgcgtatcttggccagctgctggcc
gacatccgccgcctgatgctgtaa

DBGET integrated database retrieval system