KEGG   Laribacter hongkongensis: LHK_00313Help
Entry
LHK_00313         CDS       T00884                                 

Gene name
ispE
Definition
(GenBank) IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00900  Terpenoid backbone biosynthesis
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LHK_00313 (ispE)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LHK_00313 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACO73308
UniProt: C1DBB1
Position
complement(300470..301306)
Genome map
AA seq 278 aa AA seqDB search
MTYQRFPAPAKLNLTLSVVGRRADGYHLLETVFRFIDLCDDIELAVRTDGAIVLDTPLPG
VSPESDLTVRAARALQQASGSPLGASIRVTKRIPMGGGLGGGSSDAATVLLALNRLWGCG
FPRERLQAIGLTLGADVPVFVFGEAAFASGIGEELTPCEVPDAWYVVLDPGVSVPTAKIF
SSTLLTRDSPISIMRSLSGATKRRNDLQAVVFQEFPQVARCHEVLSEYGEALMTGSGSCV
FLECPTEQHARTVYRSVSQDYRGFVVKGLQRHPVCGIE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatcaacgcttcccggctccggccaaactgaacctgaccctgagcgtggtgggc
cgccgtgccgacggctaccacttgctggaaaccgtgttccgcttcatcgacctgtgcgat
gacatcgaactggccgtgcgcacggacggcgccatcgttctggacacccctttgcccggc
gtttcccccgaaagcgaccttacggtccgggctgcccgggcactgcaacaggccagcggc
agcccactgggtgccagcatccgcgtgaccaagcgcatccccatgggcggcggactgggg
ggcggcagctcggatgctgcaacggtcctcctggcactgaaccggctgtggggctgtggt
ttcccgcgggaaagactccaggccatcggcctgacgctgggtgccgacgtgccggtattc
gtgtttggagaagcagcctttgccagcggaatcggcgaagaattaacaccttgcgaagtg
ccggatgcctggtacgtcgtgctggacccaggcgtatccgtacccaccgcgaaaattttt
tcgtccacgctgttgacacgcgattcgcccatctccataatgcgaagcctctcgggggca
acaaaacgcagaaacgatctgcaagctgttgttttccaagagtttccgcaggttgcaagg
tgtcatgaagtgctcagcgaatatggcgaagccctcatgacaggatcgggaagctgtgtc
tttctggaatgtccgaccgaacagcatgcacggacagtttaccgttcggtgtcgcaggac
taccgggggtttgtggtcaagggactgcaacgccatccggtctgcgggatcgagtaa

DBGET integrated database retrieval system