KEGG   Laribacter hongkongensis: LHK_00355Help
Entry
LHK_00355         CDS       T00884                                 

Gene name
pcm1
Definition
Pcm1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LHK_00355 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(337344..338021)
Genome map
AA seq 225 aa AA seqDB search
MAQSLTQRPAVTGSGLTSDRTRRRMIERLQEQGIRDERVLAALYAVPRHLFVDPALASRA
YDDTALPLGHGQTISQPLIVARMIELLLEGRTPGRVLEVGTGCGYQAAVLSRLFPEVYSV
ERIAALLDKARLNLRAARMVTPRLVHTDGRQGLPEAAPFDSIIVAAAAPAIPDELTNQLA
ANGRLVLPVGNDLEQHLWMIERTASGLRRQKLDPVKFVPLLSGRQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatccctgacccaacgccctgccgtcaccggcagcggcctgacttccgaccgg
acccggcgccgcatgatcgagcgcctgcaggaacagggcatccgtgacgaacgggtgctt
gctgcgctctatgccgtaccgcgccacctgtttgtcgatccggcactggccagccgtgcc
tatgacgacacggccctgccgctgggtcatggccagaccatttcccagcccctgatcgtg
gcacgcatgatcgaactgctgctggaaggccgcacacccgggcgcgtactggaagtcggt
actggctgcggttaccaggccgccgtgctgtcgcggctgtttcccgaggtgtattccgtc
gaacggatcgccgccctgctggacaaggcccggctcaacctgcgtgctgcgcgcatggtg
acaccacggctggtacataccgacggccggcagggcctgcccgaggctgcgccctttgac
agcatcatcgtggcggcagcggcaccggccattccggacgagctgaccaaccagctggca
gccaacggccggctggttcttccggtcggcaatgatctcgaacagcacctgtggatgatc
gaacgcaccgccagcggactacggcgccagaagctggatccggtgaaatttgtcccgctg
ctgtccggtcgccagtga

DBGET integrated database retrieval system