KEGG   Laribacter hongkongensis: LHK_00424Help
Entry
LHK_00424         CDS       T00884                                 

Definition
Glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lhk  Laribacter hongkongensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LHK_00424
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LHK_00424
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LHK_00424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
391172..391666
Genome map
AA seq 164 aa AA seqDB search
MTTVYDFSATRLDGSEQSLADYRGQVLLIVNTASECGFTPQYAGLESLYGQYRDQGFSVL
GFPCNQFGGQEPGDSEAIGQFCSTRFHVTFPLFAKVDVNGAGAHPLYRHLVKARPGILNT
EAIKWNFTKFLVGRDGEVLARYAPTTRPEELVADIEAALEQPGS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgtgtatgatttttccgccacccgcctggatggcagcgagcagtcactggcc
gattaccgcggccaggtgctgctgatcgtcaataccgccagtgaatgcggttttacgccg
cagtacgccggcctcgaatccctgtacgggcaataccgggaccagggattcagcgtgctc
gggtttccgtgcaaccagttcggcgggcaggagccgggcgacagcgaagccatcggccag
ttctgttccacgcgctttcatgtcacttttccgctgtttgccaaggtcgacgtcaacggc
gccggtgcgcacccactgtaccgtcatctggtcaaggcccgccccggcatcctgaacacc
gaggcgatcaagtggaacttcaccaaattcctggtcggtcgtgatggcgaagtactggcg
cgttatgcccccaccacccgtccggaagaactggtcgccgacatcgaggcagcgctggag
cagcccggcagctga

DBGET integrated database retrieval system