KEGG   Laribacter hongkongensis: LHK_00463Help
Entry
LHK_00463         CDS       T00884                                 

Gene name
dnaG
Definition
DnaG (EC:2.7.7.-)
Orthology
K02316  
DNA primase [EC:2.7.7.-]
Organism
lhk  Laribacter hongkongensis
Pathway
DNA replication
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:lhk03030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
430909..432663
Genome map
AA seq 584 aa AA seqDB search
MIPQDFIDQLLSRVDIVDVVERYVPLKKAGRDYMACCPFHKEKSPSFSVSPTKQFYHCFG
CGAHGTAISFLIEHGGYGFVDAVSELAQQVGLTVPQVAQEAAREEAQRRQTAETLHDVML
EAARFYKRELKRSTLAIDYLKRRGLTGEIAARFGLGWAPAGRTALQGVFPDYLDDRLLEA
GLVIRRDDGSRYDRFRERVMFPIRDVRGRVIAFGGRILDKGEPKYLNSPETPLFEKGREL
YGLFEGREAIRERNRVLVVEGYMDVVALAQHGVPYAVATLGTSTTSTHVHKLFRHADRVV
FCFDGDKAGQRAAWRALENVLPELRDGKRVDFLFLPVEHDPDSFVREYGAEALEDWIQQR
SLPLSVYLTQELAARVDLDSDEGRAELLNLAKPLVMQVKTPALAVLLRKKLAELARLSLD
DLDRLWGLRKGLGRKSGPPPVRGGHRSEMSPVRWLIRALLLEPVLAEAVEWPAVESLAGE
ARTLAELAELIQNGGVTGSVTLQERLRETALGEQLDPLWATLLADPAATATPLRDEFVAM
VEQFYGQLNRERVEQLTRRAAEGVLSESEKRELGERLRRRASTP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgattccccaggatttcatcgaccagctcctgtcccgcgtcgacatcgtcgacgtggtg
gagcgctacgtgccgctcaagaaggccgggcgcgactacatggcctgctgcccgttccac
aaggaaaaatcgccctcgttttcggtgagcccgaccaagcagttctatcactgctttggc
tgtggcgcgcacggcacggcgatttcgttcctgatcgagcacggcggctacggctttgtc
gatgccgtcagcgagctggcgcagcaggtggggctgaccgtgccgcaagtggcccaggag
gccgcccgcgaagaagcgcagcgacgccagactgcagaaaccctgcacgatgtcatgctg
gaggccgcgcgtttctacaagcgcgaactcaagcgttccacgctcgccatcgactacctg
aagcgccgtggcctgaccggcgaaatcgccgcccgtttcggcctcggctgggctccggcc
ggccgcaccgccttgcagggtgtttttcccgattatctggacgatcgcctgctcgaggcc
ggactggtgatccgtcgtgatgacggcagccgctacgaccgtttccgcgagcgggtgatg
tttcccatccgcgacgtgcgcggccgggtgattgcctttggcgggcgcattctcgacaag
ggcgaacccaaatacctcaattcgccggaaacgccgctgtttgaaaaagggcgtgaactg
tacggccttttcgaggggcgcgaggccatccgcgagcgcaaccgcgtgctggtggtcgaa
ggctacatggacgtggtggcactggcccagcacggcgtgccctacgcggtggccacgctg
ggtacctccaccacgtcgacgcacgtacacaagctgttccgccacgccgaccgcgtagtg
ttctgctttgacggcgacaaggccggccagcgcgccgcctggcgggcgctggaaaacgtg
ctgccggaactgcgtgacggcaagcgggtggatttcctgttcctgccggtcgagcatgat
ccggacagcttcgtgcgcgaatacggtgccgaagcgctggaagactggatccagcaacgc
tctctgccgttgtcggtgtacctgacccaggaactggccgcccgtgtcgaccttgacagc
gacgaaggccgggccgaactgctcaacctggccaagccgctggtcatgcaggtgaaaaca
ccggcgctggccgtgctattgcgtaaaaaactggcggagcttgcccgtctgtcgcttgat
gaccttgaccgtctgtgggggctgcgcaagggactggggcgcaagtccggtccgccaccg
gttcgtggcgggcaccgcagcgaaatgtcaccggtgcgctggctgatccgggccttgctg
ctggaacctgtgctggccgaagcggtcgaatggcctgcggtggaatccctggccggcgag
gcgcgtaccctggccgagctggccgagctgatccagaacggcggcgtcaccggcagtgtc
accttgcaggaacggctgcgtgaaacagccctgggcgagcagcttgacccgttgtgggct
accctcctggctgaccccgctgccacggccacgcccttgcgcgacgagtttgtcgccatg
gtcgagcagttttacggacagctgaaccgtgagcgcgtagaacaactgacccgccgcgcc
gccgaaggcgtgctgagcgaaagcgaaaagcgcgagttgggagaacgcctgcgcaggcgg
gcgtcaacaccctga

DBGET integrated database retrieval system