KEGG   Laribacter hongkongensis: LHK_00525Help
Entry
LHK_00525         CDS       T00884                                 

Gene name
tpiS
Definition
(GenBank) TpiS
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00051  Fructose and mannose metabolism
lhk00562  Inositol phosphate metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
lhk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_00525 (tpiS)
   00051 Fructose and mannose metabolism
    LHK_00525 (tpiS)
   00562 Inositol phosphate metabolism
    LHK_00525 (tpiS)
Enzymes [BR:lhk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LHK_00525 (tpiS)
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LHK_00525 (tpiS)
  Exosomal proteins of bladder cancer cells
   LHK_00525 (tpiS)
  Exosomal proteins of melanoma cells
   LHK_00525 (tpiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO73518
UniProt: C1DCA1
Position
493899..494642
Genome map
AA seq 247 aa AA seqDB search
MAKRVIGNWKMFGRQARNAELVAALLADPACDAGHVSLGVPTVYLGQVASLLSGRRTGLA
AQDVSRFSADGAYTGEVSAAMLADCGCREVLLGHSERRQYFGEGDASLRLKVNAVYAAGL
LPVVCVGESLSERAAGNHLAFVAAQIEGVRDVLSGRAQVCIAYEPVWAIGTGQVAGLDQI
AEMHDAIREKVFDCSGKSCNISVLYGGSVKADNVDEIMTLPQVDGALVGGASLDAAQFRK
ICETAAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgggtaatcggcaactggaagatgtttggtcggcaggcacgcaatgccgag
ctggtggcggcgttgctggctgatccggcatgtgatgccgggcatgtgtcactgggtgtg
ccgacggtgtatctgggacaggttgccagtctgttgtccgggcgccggacggggttggca
gcgcaggatgtcagccgtttttctgctgatggtgcctatacaggtgaggtttctgctgcc
atgctggccgactgcggttgccgggaggtgttgctcgggcattccgaacgtcgtcagtat
tttggcgagggcgatgcctcgttgcggttgaaggtcaacgccgtctacgctgctggtctg
ttgccggtcgtgtgcgtcggggaaagcctgtccgagcgcgcggcaggcaatcatctggcg
tttgtggctgcacaaatcgaaggggtgcgggatgtgctttccgggcgtgcgcaggtctgc
atcgcttatgagcctgtctgggcgattggcacggggcaggtggccggtctcgaccagatt
gccgagatgcatgatgccatccgtgaaaaagtttttgactgttccggaaagtcctgtaat
atctccgtcctctacggcggatcggtcaaggctgataatgtcgatgagattatgacgctg
ccgcaagttgatggtgcgctggttggtggggcttctctcgacgcggcgcagtttagaaaa
atttgcgaaacagcagcgaaatag

DBGET integrated database retrieval system