KEGG   Laribacter hongkongensis: LHK_00549Help
Entry
LHK_00549         CDS       T00884                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     LHK_00549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
516251..518056
Genome map
AA seq 601 aa AA seqDB search
MTPAEIAREALLKLAADKLPPTPEHYRRAFCEIAHQPDETNVFARELLEYIEQQPGISGL
SPRLGRLRQALEGERWHDGAELSFSVMQALAEQQTAGQDWARILRELVRLWDMPLSISQS
HKRETLERVLSVAGAQPLLLYGKLGNLLDNWKTSAASMRPADSLLTFDELPGVADESSGM
AGSFLGSSGSGPACPDDGAGMSWRTILRGTLVNGVSPRLKGYPELAQELMNLVSLLDETV
SGHDLEMLGRRLKRFWIRLELVLEQEDRLANALAGLLGVLLDNISELVGTDSRVGGQVEA
MRDILSQAPLSMRKIYQLEASLKEAVYQQGLIKHSLDEATDSMRSMLDSFISRVGMLANQ
TDTYRERFSRYGEEVALTHDVVGLHGILGRLMQDTRAIHTDLASAHDELQGARHQVEAVN
ARIELLEAELVEASTKIKEDQLTGALNRRGLDEQFMREASRAERSGQPLALALIDIDNFK
QLNDRYGHRTGDNALRYVVDLVSERVRPSDAVARFGGEEFVVLMPDTSQEQALELIERLQ
RDLTKTFFLANEDRLVITFSAGIAVWSAGESELDLIERADHAMYRAKLAGKNRVLAATDE
M
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgctgaaatcgcccgagaagcgctgctcaagctcgcggccgataagcttccg
cctacgcccgaacattaccggcgggcattctgtgaaatcgcgcaccagcccgacgaaacc
aacgtctttgcccgtgaactgctggagtacatcgagcagcagccgggtatttccgggctg
tctccgcgtctgggccggctgaggcaggcccttgaaggagagcgctggcacgatggcgcc
gaactgtcattctccgtcatgcaggcgctggccgagcagcagaccgccgggcaggactgg
gcgcgcatcctgcgcgagctggtgcgcctgtgggacatgccgctgtccatcagccagtcg
cacaagcgcgaaaccctcgaacgggtcctgtccgtagcgggggcacagccgctgttgctc
tacggcaagctcggaaacctgctggacaactggaaaaccagcgctgcttccatgcgtccg
gctgacagtctgctgacatttgacgagttgccgggtgtggctgacgaatcttccgggatg
gcaggctctttcctgggcagttcgggttcagggccggcctgtcctgatgacggtgccggc
atgtcgtggcgcaccatcctgcggggcacgctggtcaatggtgtctcaccgcgcctgaaa
ggctatccggagctggcgcaggagctgatgaaccttgtttcgctcctggatgaaacagtc
agcgggcatgatctggaaatgctcggccggcggctcaagcgcttctggatccggctcgaa
ctggtactggagcaggaggaccgtctggccaatgcgctggccggactgctgggcgtgctg
cttgacaacatttccgagctggtcgggacggattcccgcgtgggggggcaggtcgaggcc
atgcgtgacatcctgagccaggcgccgctctccatgcgcaagatctaccagctcgaagcc
agtctcaaggaggcggtgtaccagcagggcctgatcaagcacagtctggatgaagcgacc
gactcgatgcggtcgatgctcgacagcttcatcagccgggtcggcatgctggccaaccag
accgatacctatcgcgaacggttttcccgctacggcgaagaagtggccctgacgcacgat
gtggtcgggctacacggcatccttggccggctgatgcaggatacccgtgccatccatacc
gatctggcgtcggcgcatgatgaactgcaaggtgcccggcatcaggtcgaggctgtcaat
gcccggatcgaattgctggaagccgagctggtcgaggccagtaccaagatcaaggaggac
cagctgaccggggcgctgaaccggcgcgggctggacgagcagttcatgcgtgaagccagc
cgggccgagcgaagtggccagccgctggcgctggcgctgatcgacatcgacaacttcaag
caactgaatgatcgctacggtcaccgcacgggcgacaatgccttgcgctatgtggttgat
ctggtcagcgagcgggtgcgtcccagcgatgccgtggcccgtttcgggggcgaggagttt
gtcgtcctgatgccggatacctcgcaggaacaggcactggaactgatcgagcgcctgcag
cgggacctgaccaaaaccttcttcctcgccaatgaagaccgtctggtcatcaccttttcg
gccggcattgccgtctggagtgccggagagtccgaacttgacctgatcgaacgggccgat
cacgccatgtatcgtgccaagctggccggcaagaaccgggtactggcggctactgacgag
atgtag

DBGET integrated database retrieval system