KEGG   Laribacter hongkongensis: LHK_00549Help
Entry
LHK_00549         CDS       T00884                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
lhk  Laribacter hongkongensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516251..518056
Genome map
AA seq 601 aa AA seqDB search
MTPAEIAREALLKLAADKLPPTPEHYRRAFCEIAHQPDETNVFARELLEYIEQQPGISGL
SPRLGRLRQALEGERWHDGAELSFSVMQALAEQQTAGQDWARILRELVRLWDMPLSISQS
HKRETLERVLSVAGAQPLLLYGKLGNLLDNWKTSAASMRPADSLLTFDELPGVADESSGM
AGSFLGSSGSGPACPDDGAGMSWRTILRGTLVNGVSPRLKGYPELAQELMNLVSLLDETV
SGHDLEMLGRRLKRFWIRLELVLEQEDRLANALAGLLGVLLDNISELVGTDSRVGGQVEA
MRDILSQAPLSMRKIYQLEASLKEAVYQQGLIKHSLDEATDSMRSMLDSFISRVGMLANQ
TDTYRERFSRYGEEVALTHDVVGLHGILGRLMQDTRAIHTDLASAHDELQGARHQVEAVN
ARIELLEAELVEASTKIKEDQLTGALNRRGLDEQFMREASRAERSGQPLALALIDIDNFK
QLNDRYGHRTGDNALRYVVDLVSERVRPSDAVARFGGEEFVVLMPDTSQEQALELIERLQ
RDLTKTFFLANEDRLVITFSAGIAVWSAGESELDLIERADHAMYRAKLAGKNRVLAATDE
M
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgctgaaatcgcccgagaagcgctgctcaagctcgcggccgataagcttccg
cctacgcccgaacattaccggcgggcattctgtgaaatcgcgcaccagcccgacgaaacc
aacgtctttgcccgtgaactgctggagtacatcgagcagcagccgggtatttccgggctg
tctccgcgtctgggccggctgaggcaggcccttgaaggagagcgctggcacgatggcgcc
gaactgtcattctccgtcatgcaggcgctggccgagcagcagaccgccgggcaggactgg
gcgcgcatcctgcgcgagctggtgcgcctgtgggacatgccgctgtccatcagccagtcg
cacaagcgcgaaaccctcgaacgggtcctgtccgtagcgggggcacagccgctgttgctc
tacggcaagctcggaaacctgctggacaactggaaaaccagcgctgcttccatgcgtccg
gctgacagtctgctgacatttgacgagttgccgggtgtggctgacgaatcttccgggatg
gcaggctctttcctgggcagttcgggttcagggccggcctgtcctgatgacggtgccggc
atgtcgtggcgcaccatcctgcggggcacgctggtcaatggtgtctcaccgcgcctgaaa
ggctatccggagctggcgcaggagctgatgaaccttgtttcgctcctggatgaaacagtc
agcgggcatgatctggaaatgctcggccggcggctcaagcgcttctggatccggctcgaa
ctggtactggagcaggaggaccgtctggccaatgcgctggccggactgctgggcgtgctg
cttgacaacatttccgagctggtcgggacggattcccgcgtgggggggcaggtcgaggcc
atgcgtgacatcctgagccaggcgccgctctccatgcgcaagatctaccagctcgaagcc
agtctcaaggaggcggtgtaccagcagggcctgatcaagcacagtctggatgaagcgacc
gactcgatgcggtcgatgctcgacagcttcatcagccgggtcggcatgctggccaaccag
accgatacctatcgcgaacggttttcccgctacggcgaagaagtggccctgacgcacgat
gtggtcgggctacacggcatccttggccggctgatgcaggatacccgtgccatccatacc
gatctggcgtcggcgcatgatgaactgcaaggtgcccggcatcaggtcgaggctgtcaat
gcccggatcgaattgctggaagccgagctggtcgaggccagtaccaagatcaaggaggac
cagctgaccggggcgctgaaccggcgcgggctggacgagcagttcatgcgtgaagccagc
cgggccgagcgaagtggccagccgctggcgctggcgctgatcgacatcgacaacttcaag
caactgaatgatcgctacggtcaccgcacgggcgacaatgccttgcgctatgtggttgat
ctggtcagcgagcgggtgcgtcccagcgatgccgtggcccgtttcgggggcgaggagttt
gtcgtcctgatgccggatacctcgcaggaacaggcactggaactgatcgagcgcctgcag
cgggacctgaccaaaaccttcttcctcgccaatgaagaccgtctggtcatcaccttttcg
gccggcattgccgtctggagtgccggagagtccgaacttgacctgatcgaacgggccgat
cacgccatgtatcgtgccaagctggccggcaagaaccgggtactggcggctactgacgag
atgtag

DBGET integrated database retrieval system