KEGG   Laribacter hongkongensis: LHK_00566Help
Entry
LHK_00566         CDS       T00884                                 

Gene name
cheB
Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lhk  Laribacter hongkongensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LHK_00566 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LHK_00566 (cheB)
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LHK_00566 (cheB)
Two-component system [BR:lhk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   LHK_00566 (cheB)
Bacterial motility proteins [BR:lhk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LHK_00566 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535378..536460
Genome map
AA seq 360 aa AA seqDB search
MSQPVRVLVVDDSALMRNLLAELINACDGMCCVGQAADPLQARESIRLLAPDVVTLDVEM
PHMDGLEFLRRLMRLRPTPVVMVSSLTARGSEVAIEALALGAVEVVEKPGAGLGQAIPRF
AMQLTGAIQKAAQANLSRICNLNKSPAMPSLRPPARDALVLIGASTGGTEALVTLLSALP
AQMPPVLIVQHMPAGFTASFARRLDQACVLQVREAQGGEKLAPGQVWVAPGHAHLQLSAQ
AGDWRTQLVDSDPVNRHRPSVDVLFHSALKVAGRHTVAVLLTGMGRDGAQGLLALRKAGA
YTYAQDKASSVVFGMPREAIEIGAACEVASLGDMAHQMVTRMAGGAGGRAEEGKGVAAPH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcctgtacgggttctggtggtggatgattctgccctgatgcgtaatctgctg
gccgagctgatcaatgcctgtgacggcatgtgctgtgtcgggcaggcggcggatccgttg
caggcgcgtgaaagcatccgcttgctggctcctgatgtggtgacgctggatgtggaaatg
ccgcacatggacgggctggagttcttgcgtcgcctgatgcgtttgcgtccgacgccggta
gtgatggtgtccagcctgaccgctcgtggaagcgaggtcgccatcgaggccttggcgctg
ggggccgtggaggttgtggagaagccgggggctggtctggggcaggccataccgcgtttt
gcaatgcagctgaccggtgcgatccagaaagcggcacaggccaatctgtctcgaatatgc
aacttgaataaatcgccggcaatgccgtcactgcgtcctccggccagggatgccttggtc
ttgatcggggcatccaccggtggaacggaggcattggtgacgttgctttcggcattgccg
gcccagatgcctcctgtgctgatcgtccagcacatgccagccggattcacggcttcattt
gcccgtcggctggaccaggcttgcgtcttgcaggtccgtgaagcgcaaggcggggaaaaa
ctggctccggggcaggtgtgggtcgctcccgggcatgcacatttgcagctttcggcccag
gccggagactggcgtacacaactggtggacagtgatccggtcaatcgtcacagaccatct
gttgacgtgcttttccattcggcattaaaggttgccggacggcatactgtcgccgtattg
ttaaccggcatggggcgggatggtgcgcaaggcttgctcgcactacgcaaagccggtgcg
tatacctatgctcaggacaaggccagttccgtggtgtttggcatgcctcgcgaagcaatc
gaaatcggtgctgcatgcgaggttgccagtctgggggacatggcacaccagatggtcacc
cggatggcgggtggagcaggcggtcgggcagaagaggggaaaggcgtggccgctcctcac
tag

DBGET integrated database retrieval system