KEGG   Laribacter hongkongensis: LHK_00587Help
Entry
LHK_00587         CDS       T00884                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LHK_00587 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_00587 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LHK_00587 (thrC)
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LHK_00587 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(552502..553908)
Genome map
AA seq 468 aa AA seqDB search
MNYISTRGARLGSFSDILLMGLAPDGGLALPEHYPQIDRATLDAWRGLDYPALAFEIIRL
FADDIPADDLKRLVSATYRAEVFGSTDITPLKELEPGLAILELSNGPTLAFKDVAMQFLG
HVFEYVLARRGETLNILGATSGDTGSAAEYAMRGKAGINVFMLSPHGLMSPFQQAQMYSL
MDANIHNLAVRGVFDDCQDIVKAVQNDHAFKARYKIGTVNSINWARVVAQVVYYFKGYFA
ATRSNDESVSFCVPSGNFGNVCAGHIARMMGLPVRKLVVATNENDVLDEFFRTGAYRPRG
TADTHITSSPSMDISKASNFERFVFDLVGRDPARVRGLWAKVDAGGSFDLAGTDAFARVA
DFGFVSGKSSHADRLATIRSTWDRYGVLVDTHTADGLKVAAAWRETGVPMLCLETALPAK
FEETIREAVNLTPPRPAGLDDIESLPKRVTVVNADAAEIKRYVEARLG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatcagcacccgcggcgcccggctgggcagcttttccgacattctcctgatg
gggctggcccccgatggcggcttggccttgcccgagcactacccgcagatcgaccgcgcc
accctcgatgcctggcgtggccttgattacccggcactggcgtttgaaatcatccgcctg
ttcgccgacgacattcccgctgacgacctgaagcgcctggtgtctgccacctaccgcgcc
gaggtgttcggcagcaccgacattaccccgctcaaggaactggagccggggctggcgatc
ctcgagctttccaacggcccgacccttgccttcaaggacgtggccatgcagttccttggc
catgtgttcgaatacgtgctggcccgccgtggcgaaaccctcaacatcctcggtgccacg
tccggtgacaccggcagcgccgccgaatacgccatgcgtggcaaggccggcatcaatgtg
ttcatgctgagcccacacggcctgatgagcccgttccagcaggcgcagatgtacagcctg
atggatgccaacatccacaacctcgcagtgcgcggcgtgttcgacgactgccaggacatc
gtcaaggcagtgcagaacgaccacgccttcaaggcccgctacaagatcggcacggtgaat
tcgatcaactgggcacgcgtggtggcgcaggtggtgtactacttcaagggctactttgcc
gccacccgcagcaatgacgaaagcgtcagcttctgcgtgccgtcgggcaacttcggcaac
gtgtgtgccggtcacattgcccgcatgatggggcttccggtccggaagctggtggtcgcc
accaacgaaaacgacgtgctggacgaattcttccgcaccggtgcttaccgtccgcgcggc
acggctgacacccacatcacctccagcccgtcgatggacatttccaaggcgtccaacttc
gagcgcttcgtgttcgatctggtcggccgcgatccggctagggtacgcgggctgtgggcc
aaggtagacgcaggcggcagctttgatctcgccggcaccgacgcattcgcccgcgtggcg
gacttcggcttcgtatccggcaagagctcccacgctgaccggctggccaccatccgctcg
acttgggatcgctacggcgtgctggtggacacccataccgccgacggtctgaaagtggcc
gccgcgtggcgtgaaacaggggtgccgatgctgtgcctggaaacggccctgccggccaag
ttcgaggagaccatccgcgaagcggtcaacctgacaccgccacgaccggccgggctggac
gatatcgaatccctgcccaagcgggtgacggtcgtcaacgccgatgccgctgaaatcaag
cgttatgtcgaggcccggctcggctga

DBGET integrated database retrieval system