KEGG   Laribacter hongkongensis: LHK_00787Help
Entry
LHK_00787         CDS       T00884                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lhk  Laribacter hongkongensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lhk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lhk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
754594..755097
Genome map
AA seq 167 aa AA seqDB search
MTQHPPLALIAARARNGVIGLDNRMPWHLPEDLAYFKRVTLGKPVVMGRKTFESIGRPLP
GRLNIVVTRNPDWQAAGVQVAHSLDAALALAAAAAPEEIMLIGGAELYRQALPQADVLYL
TEIDAEFAGDAFFPEVDLARWRIDREEAGQRDSDGLRWRFVRYLPRG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcatcccccgctggcgctgatcgccgcccgtgcccgtaatggcgtcatcggc
ctggacaaccggatgccgtggcacctgccggaagacctggcctatttcaagcgcgtcacg
ctcggcaagccggtggtgatggggcgcaagaccttcgaatcgatcggccgcccattgccc
ggacgcctgaacatcgtggtgacccgcaatccggactggcaggctgccggcgtgcaggtg
gcacattcgctggatgcggccctagcgctggccgcagcggctgcgccggaagaaatcatg
ctgatcggcggtgccgaactgtaccggcaggcgctgccgcaggccgatgtgctgtacctc
accgaaatcgatgccgaatttgccggtgacgcctttttccccgaggtggacctggcgcgc
tggcgcattgaccgcgaagaagccgggcagcgcgacagcgacggtctgcgctggcgcttc
gtgcgctacctgccgcgcggttga

DBGET integrated database retrieval system